SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007307 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007307
Domain Number 1 Region: 488-653
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 5.36e-72
Family A middle domain of Talin 1 0.0000000351
Further Details:      
 
Domain Number 2 Region: 753-888
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.28e-54
Family I/LWEQ domain 0.000000231
Further Details:      
 
Domain Number 3 Region: 658-782
Classification Level Classification E-value
Superfamily I/LWEQ domain 4.05e-48
Family I/LWEQ domain 0.000000481
Further Details:      
 
Domain Number 4 Region: 1225-1361
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.26e-38
Family VBS domain 0.015
Further Details:      
 
Domain Number 5 Region: 195-308
Classification Level Classification E-value
Superfamily Second domain of FERM 3.53e-34
Family Second domain of FERM 0.000000558
Further Details:      
 
Domain Number 6 Region: 1075-1207
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.73e-27
Family VBS domain 0.031
Further Details:      
 
Domain Number 7 Region: 309-399
Classification Level Classification E-value
Superfamily PH domain-like 9.38e-26
Family Third domain of FERM 0.00000848
Further Details:      
 
Domain Number 8 Region: 79-136
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000833
Family First domain of FERM 0.033
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007307
Domain Number - Region: 949-1042
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000255
Family I/LWEQ domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007307   Gene: ENSGGOG00000007440   Transcript: ENSGGOT00000007500
Sequence length 1442
Comment pep:known_by_projection chromosome:gorGor3.1:9:36379541:36394713:-1 gene:ENSGGOG00000007440 transcript:ENSGGOT00000007500 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEAPAGPPSDFGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIG
ITNHDEYSLVRELMEEKKEEVTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
FQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLED
EGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDT
DPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACT
KVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNE
LLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI
KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMA
TNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASTPKASAGPQPLLVQSCKAVA
EQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQL
SQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLEKDLQEVKAAARDGKLKPLP
GETMEKCTQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARDVAGGLRSLAQAARGVAA
LTSDPAVQAIVLDTASDVLDKASSLIEEAKKAAGHPGDPESQQRLAQVAKAVTQALNRCV
SCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQAATELVQAS
RGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAK
ALSTDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRELLENP
VQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGDAISTASKALCGFTEAA
AQ
Download sequence
Identical sequences ENSGGOP00000007307 ENSGGOP00000007307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]