SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007310 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007310
Domain Number 1 Region: 3-299,338-413
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.97e-70
Family Motor proteins 0.000000825
Further Details:      
 
Domain Number 2 Region: 4403-4592
Classification Level Classification E-value
Superfamily Bet v1-like 5.86e-25
Family STAR domain 0.02
Further Details:      
 
Domain Number 3 Region: 457-537
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000000000000503
Family FHA domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007310   Gene: ENSGGOG00000006926   Transcript: ENSGGOT00000007503
Sequence length 4604
Comment pep:known_by_projection chromosome:gorGor3.1:15:21301651:21435295:1 gene:ENSGGOG00000006926 transcript:ENSGGOT00000007503 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANVQVAVRVRPLSKRETKEGGRIIVEVDGKVAKIRNLKVDNRPDGFGDSREKVMAFGFD
YCYWSVNPEDPQYASQDVIFQSFMLSIFKGVKKGFRACIYMYGKQMSGRAYTLIGLPLRV
LTGPNTKRNVFEIRVSFCDHLGHLNKIMASIITVYFSHRKVREIMKNESQVSHYHLYLKQ
HVNILPFISGLSQHVVTNYKQVIQLLEEGIANRHRITAATHVHEASSRSHAIFTIHYTQA
ILENSLPSEMASKINLVDLAGSERADPSYCKDRIAEGANINKSLVTLGIVISTLAQNSQV
FSSCQSLNSSVSNGDDSGILSSPSGTSSGGAPSRRQSYIPYRDSVLTWLLKDSLGGNSKT
IMVANTSYSETMSTLRYASSAKNIINKPRVNEVRPFQKSWSERSDEKLKELVLQNELKID
QLTKDWTQKWNDWQALMEHYSVDINRRRAGVVIDSSLPHLMALEDDVLSTGVVLYHLKGQ
WIERDHCTITSACGVVVLRPARGARCTVNGREVTASCRLTQGAVITLGKAQKFRFNHPAE
AAVLRQRRQVGEAAACGGSLEWLDLDGDLAVSRLGLSPLLWKERRALEEQCDEDHQPPRD
GETSHRAQIQQQQSYVEDLRHQILAEEIRAEKELEFDQAWISQQIKENQQCLLREETWLA
SLQQQQQEDQVAEKELEASVALDAWLQTDPEIQPSPFVQSQKRVVHLQLLRRHTLRAAER
NVRRKKVSFQLERIIKKQRLLEAQKRLEKLTTLCWLQDDSTQEPPYQVLSPDATVPRPRC
RSKLTSCSSLSPQRLCSKHMPQLHSIFLSWDPSTTLPPRPDPTHQTSEKTSSEEHLLQAA
SYPARTGCLRKNGLHSSGHGQPCTARAALSRKGASATDTCLTMSPNSVGIQEMEMGVKQP
HQMVSQGLASLRKSANKLKPRHEPKIFTSTTQTRVAKGLADPSHTQAGWRKEGNLGTHKA
AKGASCNSLYPHGPRQTAGHGKAVKTFWTEYKPPSPSRASKRHQRVLATRVRNITKKSSH
LPLGSPLKRQQNRRDPDTMVPLTDFSPVVDHSREKDNDLSDTDSNYSVDSLSCVYAKALI
EPLKPEERKWDLPEPENSESDDSQLSEDSLAEKRYQSPKNRLGGNRPTNNRGQPRTRTRA
SVRGFTAASDSDLLAQTHRSFSLDSLIDAEEELGEDQQEEPFPGSADEIPTETFWHLDNS
SLPVMDQEAICRLGPINYRTAARLDAVLPTSSSFYLDPQFQPHCMQLSRESPLMSMDSWF
SCDSKINPSSTPGIVGSLCPSPDMQEFHPCKGERLPYSSKLHQGSTELLCSARDGHTASA
ADMSRLSLWGIQRLIQPGADGTFQGRCIPDMTQQGSSEASHNSSVSNVLAASATTLSHVG
STHERDWSALQQKYLLELSCPVLEAIGAPKPAYPYLEEDSGSLAQASSKGGDTLLPVGPG
VSSNLNLNNFPIHLSRIRRLRAEKEQDSLNAKLEGVSDFFSTSEKEASYDETYSADLESL
SASRSTNAQVFAAENAIPDSMTEACEVKQNLEECLQSCRKPGLMTSSDEDFFQKNACHSN
VTTATKADHWSQGWAPLRKNSTVQPGQLSPDSHYPLEEEKTDCQESSKEAVRRHINVSFA
LPSGPELYLHSAPWNPLSSSLQPPLLETFYVTKSRDALTETALEIPACREVRVPSPPPRE
AWGFGHNHQALQGAYLKNNLPVLLQNQNSKIASSHQVTAEIPIDLNTREVIRESGKCPGN
ITEESHDSVYSSVTQNRHFLPSTSTKVCEFENQVVILNKKHSFPALEGGEVTAQSCCSAS
SDSTESGKSLLLFRESEAREEEELDQNTVLRQTINVSLEKDMPGESAVSLKSRSVDRRVS
SPVMVAQDGGPTPKWEGKNETGLREKGLHPKDSSEEFKLPGTKPAYERFQLVACPQERNP
SECKSQEMLNPNREPSGKKQNKRVNNTDEMARLIRSVMQLENGILEIESKQNKQVHASHT
PGTDKKLVFQDQKEQEKTDHAFRPDSSGNPLPSKDQPSSPRQTDDTVFRDSEAGEMEVNS
IGNHPQVQKITPNPFRSREGIRESEPVREHTHPAGSDRPARDIYDSLGKHTTCREFTNTS
LHPQRMKALARALPLQPRLERSSKNNGQFVKASASLKGQPWGLGSLEELETVKGFQESQV
AEHVSSSNQEEPKAEGKVEEMPMQRGGSLQEENKVTQKFPSLSQLCRDTFFSQETVSPLL
SRTEFCTAPLHQDLSNTLPLNSPRWPRRCLHVPVALGISSLDCVLDLTMLKIHNSPLVTG
VEHQDQSTETRSHSPEGNVRGRSSEAHTAWCGSVRSMAMGSHSQSGVPESIPLGTEDRIS
ASTSPQDHGKDLRITLLGFSTSEDFASEAEVAVQKEIRVSSLNKVSSQPEKRVSFSLEED
NDQARKPRQKAEKETEDLGLTSGVSLAPVSLPRVPSPEPRLLEPSDHASMCLAILEEIRQ
AKAQRKQLHDFVARGTVLSYCETLLEPECSTRVGGRPQCKQIDQSSSDQTRNEGEAPGFH
VASLSAEAGQIDLLPDERKVQATSLSADSFQSLPNTETDREPWDPVQAFSHAAPAQDRKH
RTGELRQFAGASEPFICHSSSSEIIEKKKDATTTPSSADPLAPDSPRSSAPVEEVRRVVS
KKVVAALSSQAPCDDLRVTLHELSQPVPQETAEGIPPGSQDGSPEHQEPRTLDTTYGEVS
DNLLVTAQGEKTAHFESQSVTCDVQNSTSASGPKQDHVQCPEASTGFEEGRASPKQDTIL
PGALTRVELEAPTQQCVQCKESVGSGLTEVCRAGSKHSRPIPLPDQRPSANLEGIGEGAP
CRHPREALDGPVFSRNPEGSRTLSPSRGKESRTLPCRQPCSSQPVATHAYSSHSSTLLCF
RDGGLGKKPFKAAPHTIHPPCVVPSRAYEMDETGEISSRGPDVHLTHGLEPKDVNREFRL
TESSTCEPSTVAAVLSRAQGCRSPSAPDVRTSSFSHSATDGSVGLIGVPEKKVAEKQAST
ELEAASFPAGMYSEPLRQFRDSSVGDQNAQVCQTNPGPPATTQGPHTLDLSEGSAESKLV
AEPQHECLENTTRCFLEKPQFSTELRDHNRLDSQAKFVARLKHTCSPQEDSPWQEEEQHR
DQASGGGEGFAQGVNPLPDEDGLDGCQILVAGREEVAVAQPPVSKILSQGFKDPATVSLR
QNETPQPAAQRPGHLYTGREQPAPNHRGSLPVTTIFSGPKHSRSSPTPQFSVVSSSRSLQ
ELNLSVEPPSPTDEDTQGPNRLWNPHLRAYSSGKSVARTSLQAEDSNQKASSRLDDGTTN
HRHLKPATPPYPMPSTLSHMPTPDFTTGWMSGTLELAQQGKPEKLGVQVRPENWCSQMDK
GMLHFGSSDISPYALPWRLEEPARISWKQYVSGSAVDVACSQKPQGLTLSNVARCSSMDN
GLEDQNSPFHSHLSTYANIRDLSTTHSSTENAQGSNEAWEVFRGSSSIALGDPHIPTSPE
GVAPTLGHDRRPQFRGPSGEADCLRSKPPLAEGGAAGPVDEIMLLYPSEAGCPVEQTRTN
TFEQGTQTLGSRRHWSSTDISFAQPEASAVSAFDLASWTSMHNLSLHLSQLLHSTSELLG
SLSQPDVARREQNTKRDIPDKAPQALMMDGSTQTTVDEGSQTDLTLPTLCLQTSEAEPQG
ANVILEGLGSDTSTVSQEEGDGPGVPQKREAEETAQKMAQLLYLQEESTPYKPQSPSIPS
SHLRFQKAPLGRHLPSVSPSVSDAFLPPSSQPEESYCLVVSSPSPSSPHSPGLFPSTSEY
PGDSRVQKKLGPTSVLLVDRASSPILTLSASTQEPGLSPGSLTLLAPSAHPVEGHQKLDS
SPDPVGAPRTPVDNYSQTTDELGGSQRGRSSLQRSNGRSFLELHSPHSPQQSPKLQFSFL
RQHPQQLQPRTTIGVQSRLLTPPLRHRNQRLGNSFVPEKVASPEHCPLSGREPSQWQSRT
ENGGESSASPGEPQRTLDRPPSWGGLQHLSPCPVSELTDTAGLRGSALGLPQACQPEELL
CSSCQMCMAPEHQHHSLRDLPVHNKFSNWCGVQKGLPGGLDMTEEELGASGDLSSEKQEQ
SPPQPPNDHSQDSEWSKREQIPLQVGAQNLSLSVELTEAKLHHGFGEADALLQVLQSGTG
EALAADEPVTSTWKELYARQKKAIETLRRERAERLGNFCRTRSLSPQKQLSLLPNKDLFI
WDLDLPSRRREYLQQLRKDVVETTRSPESVSRSAHTPSDIELMLQDYQQAHEEAKVEIAR
ARDQLRERTEQEKLRIHQQIISQLLKEEDKLHTLANSSSLCTSSNGSLSSGMTSGYNSSP
ALSGQLQFPENMGHTNLPDSRDVWIGDERGGHSAVRKNSAYSRRASLGSCCCSPSSLSSL
GTCFSSSYQDLAKHVVDTSMADVMAACSDNLHNLFSCQATAGWNYQGEEQAVQLYYKVFS
STRHGFLGAGVVSQPLSHVWAAVSDPTLWPLYYKPIQTARLHQRVTNSISLVYLVCNTTL
CALKQPRDFCCVCVEAKEGHLSVMAAQSVYDTSMPRPSRKMVRGEILPSAWILQPVTVEG
KEVTRVIYLAQVELGAPGFPPQLLSSFIKQQPLVIARLASFLGS
Download sequence
Identical sequences ENSGGOP00000001024 ENSGGOP00000007310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]