SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007335 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007335
Domain Number 1 Region: 2-85
Classification Level Classification E-value
Superfamily PDZ domain-like 9.6e-26
Family PDZ domain 0.0012
Further Details:      
 
Domain Number 2 Region: 78-208
Classification Level Classification E-value
Superfamily PH domain-like 4.15e-24
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007335
Domain Number - Region: 223-353
Classification Level Classification E-value
Superfamily PH domain-like 0.000166
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007335   Gene: ENSGGOG00000007493   Transcript: ENSGGOT00000007528
Sequence length 470
Comment pep:known_by_projection chromosome:gorGor3.1:2a:1111794:1365434:1 gene:ENSGGOG00000007493 transcript:ENSGGOT00000007528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRRTVTLRRQPVGGLGLSIKGGSEHNVPVVISKIFKDQAADQTGMLFVGDAVLQVNGIHV
ENATHEEVVHLLRNAGDEVTITVEYLREAPAFLKLPLGSPGPSSDHSSGASSPLFDSGLH
LNGNSSTTAPSSPSSPIAKDPRYEKRWLDTFSVPLSMARISRYKAGTEKLRWNAFEVLAL
DGVSSGILRFYTAQDGTDWLRAVSANIRELTLQNMKMANKCCSPSDQVVHMGWVNEKLQG
ADSSQTFRPKFLALKGPSFYVFSTPPVSTFNWVQAERTYHLCEVLFRVHKFWLTEDCWLQ
ANLYLGLQDFDFEDQRPYCFSVVAGHGKSHVFNVELGSELAVWEKSFQRATFMEVQRTGS
RTYMCSWQGEMLCFTVDFALGFTCFESKTKNVLWRFKFSQLKGSSDDGKTRVKLLFQNLD
TKQIETKELEFQDLTAVLHCIHSFIAAKVASVDPGFMDSQSLARKYMYSS
Download sequence
Identical sequences ENSGGOP00000007335 ENSGGOP00000007335

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]