SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007367 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007367
Domain Number 1 Region: 12-312
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 6.8e-65
Family Bacterial PLC 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007367   Gene: ENSGGOG00000007531   Transcript: ENSGGOT00000007562
Sequence length 321
Comment pep:known_by_projection chromosome:gorGor3.1:17:52149926:52360243:1 gene:ENSGGOG00000007531 transcript:ENSGGOT00000007562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSQGKNELKLADWMATLPESMHSIPLTNLAIPGSHDSFSFYIDEASPVGPEQPETVQN
FVSVFGTVAKKLMRKWLATQTMNFTGQLGAGIRYFDLRISTKPRDPDNELYFAHGLFSAK
VNEGLEEINAFLTDHHKEVVFLDFNHFYGMQKYHHEKLVQMLKDIYGNKMCPAIFAQEVS
LKYLWEKDYQVLVFYHSPVALEVPFLWPGQMMPAPWANTTDPEKLIQFLQASITERRKKG
SFFISQVVLTPKASTVVKGVASGLRETITERALPAMMQWVRTQKPGESGINIVTADFVEL
GDFISTVIKLNYVFDEGEANT
Download sequence
Identical sequences A0A2I2ZEF6 H2PFF9 H2QQT7 Q63HM9
ENSPTRP00000028845 9598.ENSPTRP00000028845 9600.ENSPPYP00000017237 9606.ENSP00000333751 ENSPPYP00000017237 gi|53828920|ref|NP_001005473.1| NP_001005473.1.87134 NP_001005473.1.92137 XP_002815569.1.23681 XP_003811026.1.60992 XP_004058954.1.27298 XP_517786.2.37143 ENSP00000333751 ENSP00000367032 ENSPTRP00000028845 ENSGGOP00000007367 ENSPPYP00000017237 ENSP00000333751 ENSP00000367032 ENSP00000333751 ENSGGOP00000007367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]