SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007387 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007387
Domain Number 1 Region: 32-335,389-606
Classification Level Classification E-value
Superfamily SNF-like 1.96e-162
Family SNF-like 0.0000507
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007387   Gene: ENSGGOG00000007544   Transcript: ENSGGOT00000007583
Sequence length 634
Comment pep:known_by_projection chromosome:gorGor3.1:17:92958592:92979859:-1 gene:ENSGGOG00000007544 transcript:ENSGGOT00000007583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRLVLPNPGLDARIPSLAELETIEQEEASSRPKWDNKAQYMLTCLGFCVGLGNVWRFPY
LCQSHGGGAFMIPFLILLVLEGIPLLHLEFAIGQRLRRGSLGVWSSIHPALKGLGLASML
TSFIVGLYYNTIISWIMWYLFNSFQEPLPWSECPLNENQTGYVDECARSSPVDYFWYRET
LNISTSISDSGSIQWWLLLCLACAWSVLYMCTIRGIETTGKVVYITSTLPYVVLTIFLIR
GLTLKGATNGIVFLFTPNVTELVQPDTWLDAGAQVFFSFSLAFGGLISFSSYNSVHNNCE
KDSVIVSIINGFTSVYVAIVVYSVIGFRATQRYDDCFSTNILTLINGFDLPEGNVTQENF
VDMQRQCNASDPAAYAQLVFQTCDINSFLSEAVEGTGLAFIIFTEAITKMPLSPLWSVLF
FIMLFCLGLSSMFGNMEGVVVPLQDLRVIPPKWPKEVLTGLICLGTFLIGFIFTLNSGQY
WLSLLDSYAGSIPLLIIAFCEMFSVVYVYGVDRFNKDIEFMIGHKPNIFWQVTWRVVSPL
LMLIIFLFFFVVEVTQELSYSVWDPGYEEFPKSQKISYPNWVYVVVVIVAGVPSLTIPGY
AIYKLIRNHCQKPGDHQGLVSTLSTASMNGDLKY
Download sequence
Identical sequences G3QX55
ENSGGOP00000007387 XP_004059131.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]