SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007389 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007389
Domain Number 1 Region: 179-281,432-489,542-613
Classification Level Classification E-value
Superfamily Cysteine proteinases 1.79e-51
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00092
Further Details:      
 
Domain Number 2 Region: 38-122
Classification Level Classification E-value
Superfamily RING/U-box 3.18e-24
Family Zf-UBP 0.00000494
Further Details:      
 
Domain Number 3 Region: 610-710
Classification Level Classification E-value
Superfamily DUSP-like 1.96e-20
Family DUSP, domain in ubiquitin-specific proteases 0.01
Further Details:      
 
Domain Number 4 Region: 706-782
Classification Level Classification E-value
Superfamily DUSP-like 0.000000000000785
Family DUSP, domain in ubiquitin-specific proteases 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007389   Gene: ENSGGOG00000007543   Transcript: ENSGGOT00000007585
Sequence length 806
Comment pep:known_by_projection chromosome:gorGor3.1:1:79972191:80021012:-1 gene:ENSGGOG00000007543 transcript:ENSGGOT00000007585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGSNSHITILTLKVLPHFESLGKQEKIPNKMSAFRNHCPHLDSVGEITKEDLIQKSHGT
CQDCKVQGPNLWACLENRCSYVGCGESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKE
VFLDRKLGTQPSLPHVRQPHQIQENSVQDFKIPSNTTLKTPLVAVFDDLDIEADEEDELR
ARPPLTQFFLDCGGLARTDKKPAICKSYLKLMTELWHKSRPGSVVPTTLFQGIKTVNPTF
RGYSQQDAQEFLRCLMDLLHEELKEQVMEVEEDPQTITTEETMEEDKSQSDVDFQSCESC
SNSDRAENENGSRCFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKINKVNSEGEFDKD
RDSISETVDLNNQETVKVQIHSRASEYITDVHSNDLSTPQILPSNEGVNPRLSASPPKSG
NLWPGLAPPHKKAQSASPKRKKQHKKYRSVISDIFDGTIISSVQCLTCDRVSVTLETFQD
LSLPIPGKEDLAKLHSSSHPTSIVKAGSCGEAYAPQGWIAFFMEYVKRFVVSCVPSWFWG
PVVTLQDCLAAFFARDELKGDNMYSCEKCKGHYIAYCRNNLNNLWYEFDDQSVTEVSEST
VQNAEAYVLFYRKSSEEAQKERRRISNLLNIMEPSLLQFYISRQWLNKFKTFAEPGPISN
NDFLCIHGGVPPRKAGYIEDLVLMLPQNIWDNLYSRYGGGPAVNHLYICHTCQIEAEKIE
KRRKTELEIFIRPPGPIDNTKIAVTKCGNVMLRQGADSGQISEETWNFLQSIYGGGPEVI
LRPPVVHVDPDILQAEEKIEVETRSL
Download sequence
Identical sequences ENSGGOP00000007389 ENSGGOP00000007389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]