SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007433 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007433
Domain Number 1 Region: 201-485
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 2.36e-114
Family Glutaminase 0.00000639
Further Details:      
 
Domain Number 2 Region: 513-599
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.48e-17
Family Ankyrin repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007433   Gene: ENSGGOG00000007590   Transcript: ENSGGOT00000007631
Sequence length 625
Comment pep:known_by_projection chromosome:gorGor3.1:2b:79110189:79197152:1 gene:ENSGGOG00000007590 transcript:ENSGGOT00000007631 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRLRGSGMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRPAAGPAAAARLHPWWGG
GGWPAEPLARGLSSSPSEILQELGKGSTHPQPGVSPPAAPAAPGPKDGPGETDAFGNSEG
KELVASGENKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMD
MLRLTLQTTSDGVMLDKDLFKVADYIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVPFCL
QSCVKPLKYAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSL
IKQGVNNAEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEG
TDMVGILDFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCG
MYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSL
CNFHNYDNLRHFAKKLDPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDY
DSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQV
QYTPQGDSDNGKENQTVHKNLDGLL
Download sequence
Identical sequences ENSGGOP00000007433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]