SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007434 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007434
Domain Number 1 Region: 21-96,221-323,444-577
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.26e-39
Family Quinoprotein alcohol dehydrogenase-like 0.043
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007434
Domain Number - Region: 345-485
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0369
Family Quinohemoprotein amine dehydrogenase B chain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007434   Gene: ENSGGOG00000007593   Transcript: ENSGGOT00000007632
Sequence length 819
Comment pep:known_by_projection chromosome:gorGor3.1:2b:77625126:77659271:1 gene:ENSGGOG00000007593 transcript:ENSGGOT00000007632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEEENIRVVRCGGSELNFRRAVFSADSKYIFCVSGDFVKVYSTVTEECVHILHGHRNLV
TGIQLNPNNHLQLYSCSLDGTIKLWDYIDGILIKTFIVGCKLHALFTLAQAEDSVFVIVN
KEKPDIFQLVSVKLSKSSSQEVEAKELSFVLDYINQSPKCIAFGNEKYQGVYVAAVREFY
LSVYFFKKKTTSRFTLSSSRNKKHAKNNFTCVACHPTEDCIASGHMDGKIRLWRNFYDDK
KYTYTCLHWHHDMVMDLAFSVTGTSLLSGGRESVLVEWRDATEKNKEFLPRLGATIEHIS
VSPAGDLFCTSHSDNKIIIIHRNLEASAVIQGLVKDRSIFTGLMIDPRTKALVLNGKPGH
LQFYSLQNDKQLYNLDIIQQEYINDYGLIQIELTKAAFGCFGNWLATVEQRQEKETELEL
QMKLWMYNKKTQGFILNTKINMPHEDCITALCFCNAEKSEQPTLVTASKDGYFKVWILTD
DSDIYKKAVGWTCDFVGSYHKYQATNCCFSEDGSLLAVSFEEIVTIWDSVTWELKCTFCQ
RAGKIRHLCFGRLTCSKYLLGATENGILCCWNLLSCALEWNAKLNVRVMEPDPNSENIAA
ISQSSVGSDLFVFKPSEPRWGVFVPRDVPESFTSEAYQWLNRSQFYFLTKSQSLLTFSTK
SPEEKLTPTSKQLLAEESLPTTPFYFILGKHRQQQDEKLNETLENELVQLPLTENIPAIS
ELLHTPAHVLPSAAFLCSMFVNSLLLSKETKSAKEIPEDVDMEEEKESEDSDEENDFTEK
VQDTSNTGLGEDIIHQLSKSEEKELRKFRKIDYSWIAAL
Download sequence
Identical sequences ENSGGOP00000007434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]