SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007444 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007444
Domain Number 1 Region: 148-465
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.74e-123
Family Transglutaminase core 0.00000000896
Further Details:      
 
Domain Number 2 Region: 5-147
Classification Level Classification E-value
Superfamily E set domains 4.9e-46
Family Transglutaminase N-terminal domain 0.00016
Further Details:      
 
Domain Number 3 Region: 487-606
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 8.63e-25
Family Transglutaminase, two C-terminal domains 0.0018
Further Details:      
 
Domain Number 4 Region: 608-705
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.5e-24
Family Transglutaminase, two C-terminal domains 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007444   Gene: ENSGGOG00000007605   Transcript: ENSGGOT00000007642
Sequence length 710
Comment pep:known_by_projection chromosome:gorGor3.1:15:21989046:22015168:-1 gene:ENSGGOG00000007605 transcript:ENSGGOT00000007642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQVATLQLESVDLQSSRNNKEHHTQEMGVKRLTVRRGQPFYLRLSFSRPFQSQNDHITF
VAETGPKPSELLGTRATFFLTRVQPGNVWSASDFTIDSNSLQVSLFTPANAVIGHYTLKI
EISQGQGHSVTYLLGTFILLFNPWSPEDDVYLPSEILLQEYIMRDYGFVYKGHERFITSW
PWNYGQFEEDIIDICFEILNKSLYHLKNPAKDCSQRNDVVYVCRVVSAMINSNDDNGVLQ
GNWGEDYSKGVSPLEWNGSVAILQQWSARGGQPVKYGQCWVFASVMCTVMRCLGVPTRVV
SNFRSAHNVDRNLTIDTYYNRNAEMLSTQKRDKIWNFHVWNECWMIRKDLPPGYNGWQVL
DPTPQQTSSGLFCCGPASVKAIREGDVHLAYDTPFVYAEVNADEVIWLLGDGQAQEILAH
NTSSIGKEISTKMVGSDQRQSITSSYKYPEGSPEERAVFMKASRKMLGPQRASLPFLDLL
ESGGLRDQPAQLQLHLARIPDWGQDLQLLLRIQRVPDSTHPRGPIGLVVRFCAQALLHGG
GTQKPFWRHTVRMNLDFGKETQWPLLLPYSNYRNKLTDEKLIRVSGIAEVEETGRSMLVL
KDICLEPPHLSIEVSERAEVGKALRLHVTLTNTLMVALSSCTMVLEGSGLINGQIAKDLG
TLVAGHTLQIQLDLYPTKAGPRQLQVLISSNEVKEIKGYKDIFVTVAGAP
Download sequence
Identical sequences ENSGGOP00000007444 ENSGGOP00000007444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]