SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007454 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007454
Domain Number 1 Region: 23-48,97-162
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-23
Family Voltage-gated potassium channels 0.0027
Further Details:      
 
Domain Number 2 Region: 168-260
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.83e-17
Family Voltage-gated potassium channels 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007454   Gene: ENSGGOG00000007617   Transcript: ENSGGOT00000007653
Sequence length 342
Comment pep:known_by_projection chromosome:gorGor3.1:6:40394713:40409088:-1 gene:ENSGGOG00000007617 transcript:ENSGGOT00000007653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRPRARAAPEGRVRGCAVPSTMLLLLAYLAYLALGTGVFWTLEGRAAQDSSRSFQRDKW
ELLQNFTCLDRPALDSLIRDVVQAYKNGASLLSNTTSMGRWELMGSFFFSVSTITTIGYG
NLSPNTMAARLFCIFFALVGIPLNLVVLNRLGHLMQQGVNHCASRLGGTWQDPDKVRWLA
GSGALLSGLLLFLLLPPLLFSHMEGWSYTEGFYFAFITLSTVGFGDYVIGMNPSQRYPLW
YKNMVSLWILFGMAWLALINSSSPSWRRQGGYVPAATTALRKTSSPKAGDRDLTGSQSPT
PHSKDAIQRDPWESYSIWNLLLTLQAVARTASYTPFFGRRPR
Download sequence
Identical sequences ENSGGOP00000007454 ENSGGOP00000007454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]