SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007461 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007461
Domain Number 1 Region: 13-40,89-166
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.55e-25
Family Voltage-gated potassium channels 0.0038
Further Details:      
 
Domain Number 2 Region: 151-251
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.42e-18
Family Voltage-gated potassium channels 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007461   Gene: ENSGGOG00000007626   Transcript: ENSGGOT00000007661
Sequence length 309
Comment pep:known_by_projection chromosome:gorGor3.1:6:40409335:40417186:-1 gene:ENSGGOG00000007626 transcript:ENSGGOT00000007661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSAGLCSCWGGRVLPLLLAYVCYLLLGATIFQLLERQAEAQSRDQFQLEKLRFLENYTC
LDQWAMEQFVQVIMEAWVKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEA
GQVFCVFYALLGIPLNVIFLNHLGTGLRAHLATIERWEDRPRRSQVLQVLGLALFLTLGT
LVILIFPPMVFSHVEGWSFSEGFYFAFITLSTIGFGDYVVGTDPSKHYISVYRSLAAIWI
LLGLAWLALILPLGPLLLHRCCQLWLLSLRQGCGAKAAPGRRPRRGSTAARGVQVTPQDF
PISKKGLGS
Download sequence
Identical sequences G3QXC1 H2QSY2
XP_001173879.1.37143 XP_003833385.1.60992 XP_004044010.1.27298 ENSGGOP00000007461 9598.ENSPTRP00000030976 ENSPTRP00000030976 ENSPTRP00000030976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]