SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007469 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007469
Domain Number 1 Region: 580-723
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 4.53e-53
Family gamma-adaptin C-terminal appendage domain-like 0.000000119
Further Details:      
 
Domain Number 2 Region: 8-155
Classification Level Classification E-value
Superfamily ENTH/VHS domain 3.63e-49
Family VHS domain 0.0000000871
Further Details:      
 
Domain Number 3 Region: 172-300
Classification Level Classification E-value
Superfamily GAT-like domain 2.94e-36
Family GAT domain 0.00000476
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007469   Gene: ENSGGOG00000007634   Transcript: ENSGGOT00000007670
Sequence length 723
Comment pep:known_by_projection chromosome:gorGor3.1:5:8015398:8034270:1 gene:ENSGGOG00000007634 transcript:ENSGGOT00000007670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAEGESLESWLNKATNPSNRQEDWEYIIGFCDQINKELEGPQIAVRLLAHKIQSPQEW
EALQALTVLEACMKNCGRRFHNEVGKFRFLNELIKVVSPKYLGDRVSEKVKTKVIELLYS
WTMALPEEAKIKDAYHMLKRQGIVQSDPPIPVDRTLIPSPPPRPKNPVFDDEEKSKLLAK
LLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNVRLLGEMLLHYSQEDS
SDGDRELMKELFDQCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEGQ
VINGEVATLTLPDSEGNSQCSNQGTLIDLVELDTTNSLSSVLAPAPTPPSSGIPILPPPP
QASGPPRSRSSSQAEATLGPSSTSNALSWLDEELLCLGLADPAPNVPPKESAGNSQWHLL
QREQSDLDFFSPRPGTAACGASDAPLLQPSAPSSSSSQAPLPPPFPAPVVPASVPAPSAG
SFLFSTGVAPALAPKVEPAVPGHHGLTLGDSALHHLDALDQLLEEAKVTSGLVKPTTSPL
IPTTTPARPLLPFSTGPGSPLFQPLSFQSQGSPPKGPELSLASIHVPLESIKPSSALPVT
AYDKNGFRILFHFAKECPPGRPDVLVVVVSMLNTAPLPVKSIMLQAAVPKSMKVKLQPPS
GTELSPFSPIQPPAAITQVMLLANPLKEKVRLRYKLTFALGEQLSTEVGEVDQFPPVEQW
GNL
Download sequence
Identical sequences G3QXC9
XP_004041042.1.27298 ENSGGOP00000007469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]