SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007472 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007472
Domain Number 1 Region: 741-888
Classification Level Classification E-value
Superfamily Spectrin repeat 5.57e-39
Family Spectrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 203-358
Classification Level Classification E-value
Superfamily Spectrin repeat 5.57e-37
Family Spectrin repeat 0.00016
Further Details:      
 
Domain Number 3 Region: 1824-1979
Classification Level Classification E-value
Superfamily Spectrin repeat 4.19e-35
Family Spectrin repeat 0.00000193
Further Details:      
 
Domain Number 4 Region: 521-674
Classification Level Classification E-value
Superfamily Spectrin repeat 8.77e-34
Family Spectrin repeat 0.0000517
Further Details:      
 
Domain Number 5 Region: 1287-1424
Classification Level Classification E-value
Superfamily Spectrin repeat 1.24e-32
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 6 Region: 418-569
Classification Level Classification E-value
Superfamily Spectrin repeat 4.05e-32
Family Spectrin repeat 0.00014
Further Details:      
 
Domain Number 7 Region: 1396-1536
Classification Level Classification E-value
Superfamily Spectrin repeat 9.84e-32
Family Spectrin repeat 0.0000313
Further Details:      
 
Domain Number 8 Region: 12-145
Classification Level Classification E-value
Superfamily Spectrin repeat 1.66e-30
Family Spectrin repeat 0.0000147
Further Details:      
 
Domain Number 9 Region: 1632-1765
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-29
Family Spectrin repeat 0.00000176
Further Details:      
 
Domain Number 10 Region: 1929-2084
Classification Level Classification E-value
Superfamily Spectrin repeat 9.16e-29
Family Spectrin repeat 0.00094
Further Details:      
 
Domain Number 11 Region: 2091-2204
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-26
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 12 Region: 2313-2470
Classification Level Classification E-value
Superfamily EF-hand 5.98e-24
Family Calmodulin-like 0.0041
Further Details:      
 
Domain Number 13 Region: 2206-2321
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-20
Family Spectrin repeat 0.00079
Further Details:      
 
Domain Number 14 Region: 1553-1662
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-20
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 15 Region: 966-1028
Classification Level Classification E-value
Superfamily SH3-domain 6.3e-20
Family SH3-domain 0.0000384
Further Details:      
 
Domain Number 16 Region: 1057-1164
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-19
Family Spectrin repeat 0.0013
Further Details:      
 
Domain Number 17 Region: 889-960
Classification Level Classification E-value
Superfamily Spectrin repeat 3.45e-19
Family Spectrin repeat 0.001
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007472
Domain Number - Region: 1208-1232
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0555
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007472   Gene: ENSGGOG00000007615   Transcript: ENSGGOT00000007673
Sequence length 2477
Comment pep:known_by_projection chromosome:gorGor3.1:9:112103686:112172709:1 gene:ENSGGOG00000007615 transcript:ENSGGOT00000007673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPSGVKVLETAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWI
QEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETI
RTRLMELHRQWELLLEKMREKGIKLLQAQKLVQYLRECEDVMDWINDKEAIVTSEELGQD
LEHVEVLQKKFEEFQTDMAAHEERVNEVNQFAAKLIQEQHPEEELIKTKQDEVNAAWQRL
KGLALQRQGKLFGAAEVQRFNRDVDETISWIKEKEQLMASDDFGRDLASVQALLRKHEGL
ERDLAALEDKVKALCAEADRLQQSHPLSATQIQVKREELITNWEQIRTLAAERHARLNDS
YRLQRFLADFRDLTSWVTEMKALINADELANDVAGAEALLDRHQEHKGEIDAHEDSFKSA
DESGQALLAAGHYASDEVREKLTVLSEERAALLELWELRRQQYEQCMDLQLFYRDTEQVD
NWMSKQEAFLLNEDLGDSLDSVEALLKKHEDFEKSLSAQEEKITALDEFATKLIQNNHYA
MEDVATRRDALLSRRNALHERAMRRRAQLADSFHLQQFFRDSDELKSWVNEKMKTATDEA
YKDPSNLQGKVQKHQAFEAELSANQSRIDALEKAGQKLIDVNHYAKDEVAARMNEVISLW
KKLLEATELKGIKLREANQQQQFNRNVEDIELWLYEVEGHLASDDYGKDLTNVQNLQKKH
ALLEADVAAHQDRIDGITIQARQFQDAGHFDAENIKKKQEALVARYEALKEPMVARKQKL
ADSLRLQQLFRDVEDEETWIREKEPIAASTNRGKDLIGVQNLLKKHQALQAEIAGHEPRI
KAVTQKGNAMVEEGHFAAEDVKAKLHELNQKWEALKAKASQRRQDLEDSLQAQQYFADAN
EAESWMREKEPIVGSTDYGKDEDSAEALLKKHEALMSDLSAYGSSIQALREQAQSCRQQV
APMDDETGKELVLALYDYQEKSPREVTMKKGDILTLLNSTNKDWWKVEVNDRQGFVPAAY
VKKLDPAQSASRENLLEEQGSIALRQEQIDNQTRITKEAGSVSLRMKQVEELYHSLLELG
EKRKGMLEKSCKKFMLFREANELQQWINEKEAALTSEEVGADLEQVEVLQKKFDDFQKDL
KANESRLKDINKVAEDLESEGLMAEEVQAVQQQEVYGMMPRDETDSKTASPWKSARLMVH
TVATFNSIKELNERWRSLQQLAEERSQLLGSAHEVQRFHRDADETKEWIEEKNQALNTDN
YGHDLASVQALQRKHEGFERDLAALGDKVNSLGETAERLIQSHPESAEDLQEKCTELNQA
WSSLGKRADQRKAKLGDSHDLQRFLSDFRDLMSWINGIRGLVSSDELAKDVTGAEALLER
HQEHRTEIDARAGTFQAFEQFGQQLLAHGHYASPEIKQKLDILDQERADLEKAWVQRRMM
LDQCLELQLFHRDCEQAENWMAAREAFLNTEDKGDSLDSVEALIKKHEDFDKAINVQEEK
IAALQAFADQLIAAGHYAKGDISSRRNEVLDRWRRLKAQMIEKRSKLGESQTLQQFSRDV
DEIEAWISEKLQTASDESYKDPTNIQLSKLLSKHQKHQAFEAELHANADRIRGVIDMGNS
LIERGACAGSEDAVKARLAALADQWQFLVQKSAEKSQKLKEANKQQNFNTGIKDFDFWLS
EVEALLASEDYGKDLASVNNLLKKHQLLEADISAHEDRLKDLNSQADSLMTSSAFDTSQV
KDKRDTINGRFQKIKSMAASRRAKLNESHRLHQFFRDMDDEESWIKEKKLLVGSEDYGRD
LTGVQNLRKKHKRLEAELAAHEPAIQGVLDTGKKLSDDNTIGKEEIQQRLAQFVEHWKEL
KQLAAARGQRLEESLEYQQFVANVEEEEAWINEKMTLVASEDYGDTLAAIQGLLKKHEAF
ETDFTVHKDRVNDVCTNGQDLIKKNNHHEENISSKMKGLNGKVSDLEKAAAQRKAKLDEN
SAFLQFNWKADVVESWIGEKENSLKTDDYGRDLSSVQTLLTKQETFDAGLQAFQQEGIAN
ITALKDQLLAAKHVQSKAIEARHASLMKRWSQLLANSATRKKKLLEAQSHFRKVEDLFLT
FAKKASAFNSWFENAEEDLTDPVRCNSLEEIKALREAHDAFRSSLSSAQADFNQLAELDR
QIKSFRVASNPYTWFTMEALEETWRNLQKIIKERELELQKEQRRQEENDKLRQEFAQHAN
AFHQWIQETRTYLLDGSCMVEESGTLESQLEATKRKHQEIRAMRSQLKKIEDLGAAMEEA
LILDNKYTEHSTVGLAQQWDQLDQLGMRMQHNLEQQIQARNTTGVTEEALKEFSMMFKHF
DKDKSGRLNHQEFKSCLRSLGYDLPMVEEGEPDPEFEAILDTVDPNRDGHVSLQEYMAFM
ISRETENVKSSEEIESAFRALSSEGKPYVTKEELYQNLTREQADYCVSHMKPYVDGKGRE
LPTAFDYVEFTRSLFVN
Download sequence
Identical sequences A0A2I2ZBV3
ENSGGOP00000007472 ENSGGOP00000007472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]