SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007484 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007484
Domain Number 1 Region: 45-680
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.04e-216
Family Motor proteins 0.0000000114
Further Details:      
 
Domain Number 2 Region: 1095-1192
Classification Level Classification E-value
Superfamily PH domain-like 9.71e-28
Family Pleckstrin-homology domain (PH domain) 0.0096
Further Details:      
 
Domain Number 3 Region: 1275-1394
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-21
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 
Domain Number 4 Region: 1678-1747,1790-1834
Classification Level Classification E-value
Superfamily Second domain of FERM 9.07e-18
Family Second domain of FERM 0.0082
Further Details:      
 
Domain Number 5 Region: 1212-1267
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000202
Family Pleckstrin-homology domain (PH domain) 0.0068
Further Details:      
 
Domain Number 6 Region: 1058-1096
Classification Level Classification E-value
Superfamily PH domain-like 0.000000167
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007484
Domain Number - Region: 704-813,1098-1123
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00101
Family BAR domain 0.045
Further Details:      
 
Domain Number - Region: 1585-1671
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.02
Family Ras-binding domain, RBD 0.024
Further Details:      
 
Domain Number - Region: 1838-1924
Classification Level Classification E-value
Superfamily PH domain-like 0.0461
Family Third domain of FERM 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007484   Gene: ENSGGOG00000007641   Transcript: ENSGGOT00000007686
Sequence length 1942
Comment pep:known_by_projection chromosome:gorGor3.1:17:76880454:77163366:1 gene:ENSGGOG00000007641 transcript:ENSGGOT00000007686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNFFTEGTRVWLRENGQHFPSTVNSCAEGIVVFRTDYGQVFTYKQSTITHQKVTAMHPT
NEEGVDDMASLTELHGGSIMYNLFQRYKRNQIYTYIGSILASVNPYQPIAGLYEPATMEQ
YSRRHLGELSPHIFAIANECYRCLWKRHDNQCILISGESGAGKTESTKLILKFLSVISQQ
SLELSLKEKTSCVERAILESSPIMEAFGNAKTVYNNNSSRFGKFVQLNICQKGNIQGGRI
VDYLLEKNRVVRQNPGERNYHIFYALLAGLEHEERALGRSAELLGLDPTQLTDALTQRSM
FLRGEEILTPLSVQQVNHFEQFNINYANEKLQEYFNKHIFSLEQLEYSREGLVWEDIDWI
DNGECLDLIEKKLGLLALINEESHFPQATDSTLLEKLHSQHANNHFYVKPRVAVNNFGVK
HYAGEVQYDVRGILEKNRDTFRDDLLNLLRESRFDFIYDLFEHVSSRNNQDTLKCGSKHR
RPTVSSQFKDSLHSLMATLSSSNPFFVRCIKPNMQKMPDQFDQAVVLNQLRYSGMLETVR
IRKAGYAVRRPFQDFYKRQEGAELDSLSFQRVLMRNLALPEDVRGKCTSLLQLYDASNSE
WQLGKTKVFLRESLEQKLEKRREEEVSHAAMVIRAHVLGFLARKQYRKVLYCVVIIQKNY
RAFLLRRRFLHLKKAAIVFQKQLRGQIARRVYRQLLAEKREQEEKKKQEEEEKKKREEEE
RERERERREAELRAQQEEETRKQQELEALQKSQTEAELTRELEKQKENKQVEEILRLEKE
IEDLQRMKEQQELSLTEASLQKLQERRDQELRRLEEEACRAAQEFLESLNFDEIDECVRN
IERSLSVGSEFSSELAESACEEKPNFNFSQPYPEEEVDEGFEADDDAFKDSPNPSEHGHS
DQRTSGIRTSDDSSEEDPYMNDTVVPTSPSADSTVLLAPSVQDSGSLHNSSSGESTYCMP
QNAGDLPSPDGDYDYDQDDYEDGAITSGSSVTFSNSYGSQWSPDYRCSVGTYNSSGAYRF
SSEGAQSSFEDSEEDFDSRFDTDDELSYRRDSVYSCVTLPYFHSFLYMKGGLMNSWKRRW
CVLKDETFLWFRSKQEALKQGWLHKKGGGSSTLSRRNWKKRWFVLRQSKLMYFENDSEEK
LKGTVEVRTAKEIIDNTTKENGIDIIMADRTFHLIAESPEDASQWFSVLSQVHASTDQEI
QEMHDEQANPQNAVGTLDVGLIDSVCASDSPDRPNSFVIITANRVLHCNADTPEEMHHWI
TLLQRSKGDTRVEGQEFIVRGWLHKEVKNSPKMSSLKLKKRWFVLTHNSLDYYKSSEKNA
LKLGTLVLNSLCSVVPPDEKIFKETGYWNVTVYGRKHCYRLYTKLLNEATRWSSAIQNVT
DTKAPIDTPTQQLIQDIKENCLNSDVVEQIYKRNPILRYTHHPLHSPLLPLPYGDINLNL
LKDKGYTTLQDEAIKIFNSLQQLESMSDPIPIIQGILQTGHDLRPLRDELYCQLIKQTNK
VPHPGSVGNLYSWQILTCLSCTFLPSRGILKYLKFHLKRIREQFPGTEMEKYALFTYESL
KKTKCREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAME
DSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAATSEVGDLPWKFYFKLYCFLDTDN
VPKDSVEFAFMFEQAHEAVIHGHHPAPEENLQVLAALRLQYLQGDYTLHAAVPPLEEVYS
LQRLKARISQSTKTFTPCERLEKRRTSFLEGTLRRSFRTGSVVRQKVEEEQMLDMWIKEE
VSSARASIIDKWKKFQGMNQEQAMAKYMALIKEWPGYGSTLFDVECKEGGFPQELWLGVS
ADAVSVYKRGEGRPLEVFQYEHILSFGAPLANTYKIVVDERELLFETSEVVDVAKLMKAY
ISMIVKKRYSTTRSASSQGSSR
Download sequence
Identical sequences ENSGGOP00000007484 ENSGGOP00000025771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]