SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007498 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007498
Domain Number 1 Region: 213-307
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.71e-25
Family Ras-binding domain, RBD 0.00000763
Further Details:      
 
Domain Number 2 Region: 4-105
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.27e-24
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 3 Region: 950-1055
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-22
Family PDZ domain 0.0000272
Further Details:      
 
Domain Number 4 Region: 366-462
Classification Level Classification E-value
Superfamily SMAD/FHA domain 3.31e-21
Family FHA domain 0.00000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007498   Gene: ENSGGOG00000007655   Transcript: ENSGGOT00000007700
Sequence length 1770
Comment pep:known_by_projection chromosome:gorGor3.1:6:169005496:169109818:1 gene:ENSGGOG00000007655 transcript:ENSGGOT00000007700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYE
VHVSGEERRLDIDEKPLVVQLNWNKDDREGRFVLKNENDAIPPKKAQSNGPEKQEKEGVI
QNFKRTLFMQEKKMYKGVFKESFSKFPIIIKHVVNSTDSENSRLAAEVYKDMPETSFTRT
ISNPEVVMKRRRQQKLEKRMQEFRSSDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPA
DFAVAEALEKYGLEKENPKDYCIAREVHSDEKGAKEIILDDDECPLQIFREWPSDKGILV
FQLKRRPPDHIPKKTKKHLEGKTPKGKERADGSGYGSTLPPEKLPYLVELSPGRRNHFAY
YNYHTYEDGSDSRDKPKLYRLQLSVTEVGTEKLDDNSIQLFGPGIQPHHCDLTNMDGVVT
VTPRSMDAETYVEGQRISETTMLQSGMKVQFGASHVFKFVDPSQDHALAKRSVDGGLMVK
GPRHKPGIVQETTFDLGGDIHSGTALPTSKSTTRLDSDRVSSASSTAERGMVKPMIRVEQ
QPDYRRQESRTQDASGPELILPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYM
ACRYVLSNQYRPDISPTERTHKVIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLN
FIKQDRDLSRITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLDDPEENSLQRPKID
DVLHTLTGAMSLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHYWGAIIR
QQLGHIEAWAEKQGLELAADCHLSRIVQATTLLTMDKYAPDDIPNINSTCFKLNSLQLQA
LLQNYHCAPDEPFIPTDLIENVVAVAENTADELARSDGREVQLEEDPDLQLPFLLPEDGY
SCDVVRNIPNGLQEFLDPLCQRGKLVYMPESELHPRLKILFTLWHIGMTCIEHVTSAQPL
RKEPEIITVTLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSV
DGRSLVGLSQERAAELMTRTSSVVTLEVAKQGAIYHGLATLLNQPSPMMQRISDRRGSGK
PRPKSEGFELYNNSTQNGSPESPQLPWAEYSEPKKLPGDDRLMKNRADHRSSPNVANQPP
SPGGKSTYASGTTAKITSVSTGNLCTEEQTPPPRPEAYPIPTQTYTREYFTFPASKSQDR
MAPPQNQWPNYEEKPHMHTDSNHSSIAIQRVTRSQEELREDKAYQLERHRIEAAMDRKSD
SDMWINQSSSLDSSTSSQEHLNHSSKSAAAIPATPVAVSQPIRTDLPPPPPPPPVHYAGD
FDGMSMDLPLPPPPSANQIGLPSAQVAAAERKKREEHQRWYEKEKARLEEERERKRREQE
RKLGQMRTQSLNPAPFSPLTAQQMKPEKPSTLQRPQETVIRELQPQQQPRTIERRDLQYI
TVSKEELSSGDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQSKPDRSAEESDRLR
KLMLEWQFQKRLTMLIMQRLEAERRARQTAMPAISVLDLLQDEERRRQQQLEEMRKREAE
DRARQEEERRRQEEERTKRDAEEKRRQEEGYYSHLEAERRRQHDEAARRLLEPEAPGLCR
PPLPRDYSFQPPSAKANSTDHKKGQPPPPPKKSSSYHPSHCKGPETPVTDEFCTAGPFVE
EEKQKLKGVRKGPNSYPGPTGAAVGAHDACRDAKEKRSKSQDADSPGSSGAPENLTFKER
QRLFSQGQDVSNKVKASRKLTELENELNTK
Download sequence
Identical sequences ENSGGOP00000007498 ENSGGOP00000007498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]