SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007501 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007501
Domain Number 1 Region: 100-303
Classification Level Classification E-value
Superfamily Glycerol-3-phosphate (1)-acyltransferase 3.66e-20
Family Glycerol-3-phosphate (1)-acyltransferase 0.027
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007501
Domain Number - Region: 356-421
Classification Level Classification E-value
Superfamily EF-hand 0.00169
Family Calmodulin-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007501   Gene: ENSGGOG00000007665   Transcript: ENSGGOT00000007703
Sequence length 529
Comment pep:known_by_projection chromosome:gorGor3.1:15:12769054:12777232:-1 gene:ENSGGOG00000007665 transcript:ENSGGOT00000007703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQGSPGDWAPLDPTPGPPASPNPFVHELHLSRLQRVKFCLLGALLAPIRVLLAFIVLFL
LWPFAWLQVAGLSEEQLQEPITGWRKTVCHNGVLGLSRLLFFLLGFLRIRVRGQRASRLQ
APVLVAAPHSTFFDPIVLLPCDLPKVVSRAENLSVPVIGAFPTPALLRFNQAILVSRHDP
ASRRRVVEEVRRRATSGGKWPQVLFFPEGTCSNKKALLKFKPGAFIAGVPVQPVLIRYPN
SLDTTSWAWRGPGVLKVLWLTASQPCSIVDVEFLPVYHPSPEESRDPTLYANNVQRVMAQ
ALGIPATECEFVGSLPVIVVGRLKVALEPQLWELGKVLRKAGLSPGYVDAGAEPGRSRMI
SQEEFARQLQLSDPQTVAGAFGYFQQDTKGLVDFRDVALALAALDGGRSLEELTRLAFEL
FAEEQAEGPNHLLYKDGFSTILHLLLGSPRPAATALHAELCQAGSSQGLSLCQFQNFSLH
DPLYGKLFSTYLRPPHTSRGTSQTPNASSPGNPTALANGTVQAPKQKGD
Download sequence
Identical sequences ENSGGOP00000007501 ENSGGOP00000007501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]