SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007534 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007534
Domain Number 1 Region: 110-289
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 6.02e-47
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.00032
Further Details:      
 
Domain Number 2 Region: 291-398
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.28e-22
Family HCDH C-domain-like 0.00083
Further Details:      
 
Domain Number 3 Region: 428-518
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 4e-20
Family HCDH C-domain-like 0.003
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007534
Domain Number - Region: 40-92
Classification Level Classification E-value
Superfamily ClpP/crotonase 0.0907
Family Crotonase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007534   Gene: ENSGGOG00000007702   Transcript: ENSGGOT00000007736
Sequence length 536
Comment pep:known_by_projection chromosome:gorGor3.1:3:186582005:186598110:-1 gene:ENSGGOG00000007702 transcript:ENSGGOT00000007736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSDQPLESRRLCNKPIQSLPNMDSIFSEALLKMRRQHPGCLAQEACVRAVQAAVQYPYEV
GIKKEEELFLYLLQSGQARALQYAFFAERKANKWSTPSGASWKTASARPVSSVGVVGLGT
MGRGIVISFARARIPVIAVDSDKNQLATANKMITSVLEKEASKMQQSGHPWSGPKPRLTS
SMKELGGVDLVIEAVFEEMSLKKQVFAELSAVCKPEAFLCTNTSALDIDEIASSTDRPHL
VIGTHFFSPAHVMKLLEVIPSQYSSPTTIATVMNLSKKIKKIGVVVGNCFGFVGNRMLNP
YYNQAYFLLEEGSKPEEVDQVLEEFGFKMGPFRVSDLAGLDVGWKSRKGQGLTGPTLPPG
TPARKRGNRRYCPIPDVLCELGRFGQKTGKGWYQYDKPLGRIHKPDPWLSKFLSQYRETH
HIEPRTISQDEILERCLYSLINEAFRILGEGIAASPEHIDVVYLHGYGWPRHKGGPMFYA
STVGLPRVLEKLQKYYRQNPDIPQLEPSDYLKKLASQGNPPLKEWQSLAGSPSSKL
Download sequence
Identical sequences ENSGGOP00000007534 ENSGGOP00000007534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]