SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007535 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007535
Domain Number 1 Region: 1024-1199
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 1.01e-56
Family Crystallins/Ca-binding development proteins 0.0000703
Further Details:      
 
Domain Number 2 Region: 840-1011
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 1.68e-45
Family Crystallins/Ca-binding development proteins 0.00066
Further Details:      
 
Domain Number 3 Region: 1212-1380
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 4.67e-45
Family Crystallins/Ca-binding development proteins 0.00059
Further Details:      
 
Domain Number 4 Region: 1385-1515
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.32e-18
Family Ricin B-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007535   Gene: ENSGGOG00000007699   Transcript: ENSGGOT00000007737
Sequence length 1517
Comment pep:known_by_projection chromosome:gorGor3.1:1:27256583:27282087:-1 gene:ENSGGOG00000007699 transcript:ENSGGOT00000007737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEAGGPMARAKARVVSATLTWRQRPPTQEEIKHGFHKVSLVSGAQMEAPQKEMFEFSRR
EEVEVNGFATQEEETVNCQGPQDTAGSKNFQSHGPIFSKKYIPPPKEKRPEGRLKEAVDQ
SDGSRQAPRTEPPCVGAMARTELLVPLPGPREPSPHPGVGLTSGSSRSLEEYRVTRTVRT
TTVVGGHVDRRVSSSVTVRPVSSGEALPRGRQVARMVPPVVVGSPPGSPSRSQAVKVLSN
LVPAGHSPPASHLPRPTAGGPRSTGLGSTVGAALRQLPETGTAELKNSSALASTGIPASA
HLPKNQDAPAACPDRDQGRAPDARACELRQVLGAPSSTELPLQTSQGQASVPSSPRLETH
VPSPGLTHPAKQPVVPTHPRAQLTPLVLPPKKKEGPVDPPAATILPMVRSEHVTVPGQPP
APSTTRRKDVPSPGGLSAPSSPRNKFVQNSENVPVLPFTQRKEVVKGPGAPAASSPTQKE
VVQGPGAPAALSPKSTEVVQGPKGSTSIQKEAVQGIAGSLAPPLTKEETLQGPIAPATSL
PKQDKGVQDSEGSPISSLTQKEVVQDPAALPAPSSSVDRVSPSPGGTPAPVPTGAEASTE
SHLVSDPTEGKTCTETSREEDEVALAADLEIFLDTLRSMEPPEILRTHRLPRAPRSSYLS
MYATLPAIEEDQLGPWVLGPGPQEVPSQPENPYLSDDEKLQRRQEKAGPSPSRDLHPARP
TQVSCSPLEMMKKHVAGTKGPHSELGLELQGGSRPTSRLGGSLLFGSLVPATKEASTPEP
LGTKLSALLPHGAPGLRKVAGQLPLLCSERSSPTEKLACSLPLEGWSPALKTQGKPNTRP
GKVIFFSESGCQGSSREVWGDIVDASGWAPVASIRVVRGCWVLYEEPEFRGQKLVLPEGD
MELRTPGTKWSPQGIGSLRRVVWDYSTPEISLFSEEGLKGEQVKLTEALKNSQGLEKPLQ
VASATVSAGLWLLYPKPLFEDTPYILEPGEYPTSEAWGTSDPSVGSLKPMRLGCPSVEKP
GEPRAVVYEAPGFQGRSWEVSRDIYNLQQPEDSQSPHLASVGSLRVLGGCWVGYEKEGFR
GHQYLLEEGEYPDWSHWGGYDELLTSLRVIRTDFGDPAVVLFEAMDFEGHGVEVSKALPD
VELVQHGPSTQAIHVLSGVWVAYQEVGFSGEQYVLEKGVYRNCEDWGAGNSTLASLQPVL
QVGEHDLHFVSKIQLFSRPDFLGDHFSFEDDQAALPASFRPQSCRVHGGSWILFDEKNFE
GDQHILSEGEFPTLTAMGCLASTVLGSLQKVSLHFSEPSIFLYGLECFEGKEIELSREVR
SLQAEGFNNHVLSVRIKGGIWVLCEHSDFRGRQWLVGSCEITNWLTYSGTQRVGSLYPIK
QQHRVYFRLWNAALGGFLAVPDHVEDMKAGRVVVADPRAGGSCIWYYEDGLLKNQMAPTM
SLQVIGPPSPGSKVVLWAESRLPRQTWSISESGHICSQMFEGQILDVKGGRGYDRDHVVL
WEPDEDRASQIWTIHVL
Download sequence
Identical sequences ENSGGOP00000007535 ENSGGOP00000007535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]