SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007537 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007537
Domain Number 1 Region: 279-616
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.66e-74
Family YicI catalytic domain-like 0.0054
Further Details:      
 
Domain Number 2 Region: 598-676
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 8.63e-17
Family Putative glucosidase YicI, domain 3 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007537   Gene: ENSGGOG00000007706   Transcript: ENSGGOT00000007739
Sequence length 680
Comment pep:known_by_projection chromosome:gorGor3.1:9:35033321:35035360:-1 gene:ENSGGOG00000007706 transcript:ENSGGOT00000007739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYTFLPDNFSPAKPKPSKELKPLLGSAVLGLLLVLAAVVAWCYYSVSLRKAERLRAELLD
LKAGGFSIRNQKGEQVFRLAFRSGALDLDSCSRDGALLGCSLTADGRPLHFFIQTVRPKD
TVMCYRVRWEEAAPGRAVEHAMFLGDAAAHWYGGAEMRTQHWPIRLDGQQEPQPFVTSDV
YSSDAAFGGILERYWLSSRAAAIKVNDSVPFHLGWNSTERSLRLQARYHDTPYKPPAGRA
AAPELSYRVCVGSDVTSIHKYMVRRYFNKPSRVPAPEAFRDPIWSTWALYGRAVDQDKVL
RFAQQIRQHHFNSSHLEIDDMYTPAYGDFDFDEVKFPNASDMFRRLRDAGFRVTLWVHPF
VNYNSSRFGEGVERELFVREPTGRLPALVRWWNGIGAVLDFTHPKARDWFQGHLRRLRSR
YSVASFKFDAGEVSYLPRDFSTYRPLPDPSVWSRRYTEMALPFFSLAEVRVGYQSQNISC
FFRLVDRDSVWGYDLGLRSLIPAVLTVSMLGYPFILPDMVGGNAVPQRTAGGDVPERELY
IRWLEVAAFMPAMQFSIPPWRYDAEVVAIAQKFAALRASLVAPLLLELAGEVTDTGDPIV
RPLWWIAPGDETAHRIDSQFLIGDTLLVAPVLEPGKQERDVYLPAGKWRSYKGELFDKTP
VLLTDYPVDLDEIAYFTWAS
Download sequence
Identical sequences ENSGGOP00000007537 ENSGGOP00000007537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]