SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007560 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007560
Domain Number 1 Region: 189-300
Classification Level Classification E-value
Superfamily PH domain-like 2.01e-37
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 2 Region: 86-195
Classification Level Classification E-value
Superfamily PDZ domain-like 5.26e-25
Family PDZ domain 0.00033
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007560
Domain Number - Region: 337-436
Classification Level Classification E-value
Superfamily PH domain-like 0.00566
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007560   Gene: ENSGGOG00000007727   Transcript: ENSGGOT00000007762
Sequence length 540
Comment pep:known_by_projection chromosome:gorGor3.1:16:59367753:59484433:1 gene:ENSGGOG00000007727 transcript:ENSGGOT00000007762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVAAATAAAGAGPAMAVWTRATKAGLVELLLRERWVRVVAELSGESLSLTGDAAAAELE
PALGPTAAAFNGLPNGGGAGDSLPGSPSRGLGPPSPPAPPRGPAGEAGASPPVRRVRVVK
QEAGGLGISIKGGRENRMPILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAV
QALKRAGKEVLLEVKFIREVTPYIKKPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNST
KDRKIIPLKMCFAARNLSMPDLENRLIELHSPDSRNTLILRCKDTATAHSWFVAIHTNIM
ALLPQVLAELNAMLGATSTAGGSKEVKHIAWLAEQAKLDGGRQQWRPVLMAVTEKDLLLY
DCMPWTRDAWASPCHSYPLVATRLVHSGSGCRSPSLGSDLTFATRTGSRQGIEMHLFRVE
THRDLSSWTRILVQGCHAAAELIKEVSLGCMLNGQEVRLTIHYENGFTISRENGGSSSML
YRYPFERLKMSADDGIRNLYLDFGGPEGELTMDLHSCPKPIVFVLHTFLSAKVTRMGLLV
Download sequence
Identical sequences G3QXL3
ENSGGOP00000007560 ENSGGOP00000007560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]