SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007568 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007568
Domain Number 1 Region: 292-618
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.04e-74
Family Pancreatic carboxypeptidases 0.00000196
Further Details:      
 
Domain Number 2 Region: 113-275
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.28e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.00064
Further Details:      
 
Domain Number 3 Region: 623-720
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 3.73e-17
Family Carboxypeptidase regulatory domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007568   Gene: ENSGGOG00000007734   Transcript: ENSGGOT00000007770
Sequence length 733
Comment pep:known_by_projection chromosome:gorGor3.1:20:2820790:2827312:-1 gene:ENSGGOG00000007734 transcript:ENSGGOT00000007770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGLLLALAAFAPAVGPALGAPRNSGLGLAQPGTTKVPGSIPALHSSPAQPPAETPNGTS
EQHVRIRVIKKKKVIMKKRKKLTRPTPLVTARPLVTPTPAGTLNPTEKQETGCPPLGLES
LRVSDSRLEASSSQSFGLGPHRGRLNIQSGLEDGDLYDGGWCAEEQDTDPWFQVDAGHPT
RFSGVITQGRNSVWRYDWVTSYKVQFSNDSRTWWGSRNHSSGMDAVFPANSDPETPVLNL
LPEPQVARFIRLLPQTWLQGGAPCLRAEILACPVSDPNDLFLEAPASGSSDPLDFQHHNY
KAMRKLMKQVQEQCPNITRIYSIGKSYQGLKLYVMEMSDQPGEHELGEPEVRYVAGMHGN
EALGRELLLLLMQFLCHEFLRGNPRVTRLLSEMRIHLLPSMNPDGYEIAYHRGSELVGWA
EGRWNNQSIDLNHNFADLNTPLWEAQDDGKVPHIVPNHHLPLPTYYTLPNATVAPETRAV
IKWMKRIPFVLSANLHGGELVVSYPFDMTRTPWAARELTPTPDDAVFRWLSTVYAGSNLA
MQDTSRRPCHSQDFSVHGNIINGADWHTVPGSMNDFSYLHTNCFEVTVELSCDKFPHENE
LPQEWENNKDALLTYLEQQVRMGIAGVVRDKDTELGIADAVIAVDGINHDVTTAWGGDYW
RLLTPGDYMVTASAEGYHSVTRNCRVTFEEGPFPCNFVLTKTPKQRLRELLAAGAKVPPD
LRRRLERLRGQKD
Download sequence
Identical sequences ENSGGOP00000007568 ENSGGOP00000007568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]