SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007585 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGGOP00000007585
Domain Number - Region: 175-200
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0011
Family CCCH zinc finger 0.0034
Further Details:      
 
Domain Number - Region: 17-40
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0353
Family CCCH zinc finger 0.0039
Further Details:      
 
Domain Number - Region: 211-234
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0581
Family CCCH zinc finger 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007585   Gene: ENSGGOG00000007756   Transcript: ENSGGOT00000007787
Sequence length 374
Comment pep:known_by_projection chromosome:gorGor3.1:X:129894765:129952612:-1 gene:ENSGGOG00000007756 transcript:ENSGGOT00000007787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAVNVALIRDTKWLTLEVCREFQRGTCSRADADCKFAHPPRVCHVENGRVVACFDSLKG
RCTRENCKYLHPPPHLKTQLEINGRNNLIQQKTAAAMFAQQMQLMLQNAQMSSLGSFPMT
PSLPANPPMAFNPYIPHPGMGLVPAELVPNTPVLIPGNPPLAMPGAVGPKLMRSDKLEVC
REFQRGNCTRGENDCRYAHPTDASMIEASDNTVTICMDYIKGRCSREKCKYFHPPAHLQA
RLKAAHHQMNHSAASAMALQPGTLQLIPKRSALEKPNGATPVFNPTVFHCQQALTNLQLP
QPAFIPAGPILCMAPASNIGFQLKVPMMHGATPTTVSAATTPATSVPFAAPTTGNQIPQL
SIDELNSSMFVSQM
Download sequence
Identical sequences ENSGGOP00000021070 ENSGGOP00000007585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]