SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007592 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007592
Domain Number 1 Region: 80-163
Classification Level Classification E-value
Superfamily PA domain 0.00000000889
Family PA domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007592   Gene: ENSGGOG00000007761   Transcript: ENSGGOT00000007794
Sequence length 188
Comment pep:known_by_projection chromosome:gorGor3.1:2a:74603318:74608711:-1 gene:ENSGGOG00000007761 transcript:ENSGGOT00000007794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPGAAGWCCLVLWLPACVAAHGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRY
EQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVD
NDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFEL
LQPPWTFW
Download sequence
Identical sequences A0A096NRM4 A0A2K5LE44 A0A2K5VE28 A0A2K5ZXF4 A0A2K6DYZ9 G1RHG9 G3QXN9 H2QI44 H9G0P0 Q9BSG0
9544.ENSMMUP00000016340 9598.ENSPTRP00000020695 9606.ENSP00000258083 ENSP00000258083 NP_115695.1.87134 NP_115695.1.92137 XP_003262599.1.23891 XP_007968414.1.81039 XP_011711898.1.29376 ENSPTRP00000020695 ENSGGOP00000007592 ENSP00000258083 ENSP00000258083 gi|14150090|ref|NP_115695.1| ENSNLEP00000012669 ENSPTRP00000020695 ENSPANP00000015694 NYSGRC-14150090 ENSMMUP00000016340 ENSMMUP00000016340 ENSGGOP00000007592 ENSNLEP00000012669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]