SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007619 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007619
Domain Number 1 Region: 202-339
Classification Level Classification E-value
Superfamily AXH domain 3.66e-47
Family AXH domain 0.00088
Further Details:      
 
Domain Number 2 Region: 428-505
Classification Level Classification E-value
Superfamily HMG-box 6.28e-19
Family HMG-box 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007619   Gene: ENSGGOG00000007788   Transcript: ENSGGOT00000007821
Sequence length 514
Comment pep:known_by_projection chromosome:gorGor3.1:7:104806615:104829476:1 gene:ENSGGOG00000007788 transcript:ENSGGOT00000007821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWEVKTNQMPNAVQKLLLVMDKRASGMNDSLELLQCNENLPSSPGYNSCDEHMELDDLP
ELQAVQSDPTQSGMYRLSSDVSHQEYPRSSWNQNTSDIPETTYRENEVDWLTELANIATS
PQSPLMQCSFYNRSSPVHIIATSKSLHSYARPPPVSSSSKSEPAFPHHHWKEETPVRHER
ANSESESGIFCMSSLSDDDDLGWCNSWPSTVWHCFLKGTRLCFHKGSNKEWQDVEDFARA
EGCDNEEDLQMGIHKGYGSDGLKLLSHEESVSFGESVLKLTFDPGTVEDGLLTVECKLDH
PFYVKNKGWSSFYPSLTVVQHGIPCCEVHIGDVCLPPGHPDAINFDDSGVFDTFKSYDFT
PMDSSAVYVLSSMARQRRASLSCGGPGGQDFARSGFSKNCGSPGSSQLSSNSLYAKAVKN
HSSGTVSATSPNKCKRPMNAFMLFAKKYRVEYTQMYPGKDNRAISVILGDRWKKMKNEER
RMYTLEAKALAEEQKRLNPDCWKRKRTNSGSQQH
Download sequence
Identical sequences G3QXR1
ENSGGOP00000007619 XP_004046072.1.27298 XP_018886421.1.27298 XP_018886422.1.27298 XP_018886424.1.27298 XP_018886425.1.27298 ENSGGOP00000007619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]