SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007630 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007630
Domain Number 1 Region: 77-163
Classification Level Classification E-value
Superfamily HMG-box 7.33e-31
Family HMG-box 0.0000089
Further Details:      
 
Domain Number 2 Region: 3-80
Classification Level Classification E-value
Superfamily HMG-box 3.53e-22
Family HMG-box 0.00000831
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007630
Domain Number - Region: 166-210
Classification Level Classification E-value
Superfamily ARM repeat 0.00288
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007630   Gene: ENSGGOG00000007804   Transcript: ENSGGOT00000007834
Sequence length 210
Comment pep:novel chromosome:gorGor3.1:20:55563812:55564444:-1 gene:ENSGGOG00000007804 transcript:ENSGGOT00000007834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGKGDPKKPRGKMSSYAYFVQTCQEEHKKHPDASVNFSEFSKKCSERWKTMPAKEKGKFE
DMAKADKTHYERQMKTYIPPKGETKKKFKDPSAPKRPPSAFFLFCSEYHPKIKGEHPGLS
IGDVVKKLGEMWNDTAADDKQPYEKKAAKLKEKYEKDIAAYQAKGKPEAAKRGVVKAEKS
KKKKEEEEDEEDEEDEEEDEEEDEEDADDE
Download sequence
Identical sequences ENSGGOP00000007630 ENSGGOP00000007630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]