SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007649 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007649
Domain Number 1 Region: 1391-1560,1618-1680,1746-1845
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 4.07e-116
Family Mammalian PLC 0.00000474
Further Details:      
 
Domain Number 2 Region: 241-457,496-724,752-851
Classification Level Classification E-value
Superfamily Ras GEF 2.75e-43
Family Ras GEF 0.0057
Further Details:      
 
Domain Number 3 Region: 2005-2111
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.51e-32
Family Ras-binding domain, RBD 0.00000115
Further Details:      
 
Domain Number 4 Region: 1871-1982
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.93e-22
Family PLC-like (P variant) 0.0035
Further Details:      
 
Domain Number 5 Region: 2111-2189
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.51e-22
Family Ras-binding domain, RBD 0.0000119
Further Details:      
 
Domain Number 6 Region: 1207-1238,1321-1379
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000993
Family EF-hand modules in multidomain proteins 0.033
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007649
Domain Number - Region: 854-895,929-1005
Classification Level Classification E-value
Superfamily PH domain-like 0.00283
Family Pleckstrin-homology domain (PH domain) 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007649   Gene: ENSGGOG00000007807   Transcript: ENSGGOT00000007854
Sequence length 2257
Comment pep:known_by_projection chromosome:gorGor3.1:10:107278195:107575542:1 gene:ENSGGOG00000007807 transcript:ENSGGOT00000007854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSEEMTASVLIPVTQRKVVSAQSAADESSEKVSDINISKAHTVRRSGETSHTISRLNKL
KEEPSGSNLPKILSIAREKIVSDENSNEKCWEKIMPDSAKNLNINCNNILRNHQHGLPQR
QFYEMYNSVAEEDLCLETGIPSPLERKVFPGIQLELNRPSMGISPLGNQSAIIETGRAHP
DSRRAVFHFHYEVDRRMSDTFCTLSENLILDDCGNCVPGGEEKQKKNYVAYTCKLMELAK
NCDNKNEQLQCDHCDTLNDKYFCFEGSCKKVDMVYSSDSFCRKDFTDSQAAKTFLSHFED
FPDNCDDVEEDAFKSKKERSTLLVRRFCKNDREVKKSVYTGTRAIVRTLPSGHIGLTAWS
YIDQKRNGALLPCGRVMEPPSTVEIRQDGSRRLSEAQWYPIYNAVRREETENTVGSLLHF
LTKLPASKTAHGRISVGPCLKQCVRDTVCEYRATLQRTSISQYITGSLLEATTSLGARSG
LLSTFGGSTGRMMLKERQPGPSVANSNALPSSSAGISKELIDLQPLIQFPEEVASILMEQ
EQTIYRRVLPVDYLCFLTRDLGTPECQSSLPCLKASISASILTTQNGEHNALEDLVMRFN
EVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQF
MDQSDIETMRSLKDAMAQHESSCEYRKVVTRALHIPGCKVVPFCGVFLKELCEVLDGASG
LMKLCPQYNSQEETLEFVADYSGQDNFLQRVGQNGLKNSEKESTVNSIFQVIRSCNRSLE
TDEEDSPSEGNSSRKSSLKDKSRWQFIIGDLLDSDNDIFEQSKEYDSHGSEDSQKAFDHG
TELIPWYVLSIQADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWVKPTTASPA
SSKAKLGVLNNTAEPGKFPLLGNAGLSSLTEGVLDLFAVKAVYMGHPGIDIHTVCVQNKL
GSMFLSETGVTLLYGLQTTDNRLLHFVAPKHTAKMLFSGLLELTRAVRKMRKFPDQRQQW
LRKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSARNPSPGTSAKNAEKPNMQRNNTLGIS
TTKKKKKILMRGESGEVTDDEMATRKAKMHKECRSRSGSDPQDINEQEESEANAIANPPN
PLPSRRAHSLTTAGSPNLAAGTSSPIRPVSSPVLSSSNKSPSSAWSSSSWHGRIKGGMKG
FQSFMVSDSNMSFVEFVELFKSFSVRSRKDLKDLFDVYAVPCNRSGSESAPLYTNLTIDE
NTSDLQPDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGIESTSLGIF
GVGILQLNDFLVNCQGEHCTYDEILSIIQKFEPSISMCHQGLMSFEGFARFLMDKENFAS
KNDESQENIKELQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWD
GDDGMPIIYHGHTLTTKIPFKEVVEAIDRSAFINSDLPIIISIENHCSLPQQRKMAEIFK
TVFGEKLVTKFLFETDFSDDPMLPSPDQLRRKVLLKNKKLKAHQTPVDILKQKAHQLASM
QAQAYNGGNANPPPANNEEEEDEEDEYDYDYESLSDDNILEDRPENKSCNDKLQFEYNEE
IPKRIKKADNSACNKGKVYDMELGEEFYLDQNKKESRQIAPELSDLVIYCQAVKFPGLST
LNASGSSRGKERKSRKSIFGNNPGRMSPGETASFNKTSGKSSCEGIRQTWEESSSPLNPT
TSLSAIIRTPKCYHISSLNENAAKRLCRRYSQKLIQHTACQLLRTYPAATRIDSSNPNPL
MFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLWDKNCPMYQKFSPLERD
LDSMDPAVYSLTIVSGQNVCPSNSMGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNE
QFLFRVHFEDLVFLRFAVVENNSSVVTAQRIIPLKALKRGYRHLQLRNLHNEVLEISSLF
INSRRMEENSSGNTMSASSMFNTEERKCLQTHRVTVHGVPGPEPFTVFTINGGTKAKQLL
QQILTNEQDIKPVTTDYFLMEEKYFISKEKNECRKQPFQRAIGPEEDIMQILSSWFPEEG
YVGRIVLKTQQETLCKAKYSYSILSNPNPSDYVLLEEVVKDTTNKKTTTPKSSQRVLLDQ
ECVFQAQSKWKGAGKFILKLKEQVQASREDKKKGISFASELKKLTKSTKQPRGLTSPSQL
LTSESIQTKEEKPMGGLSSSDTMDYRQVKIFQQEVKE
Download sequence
Identical sequences ENSGGOP00000007649 ENSGGOP00000024380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]