SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007650 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007650
Domain Number 1 Region: 890-1067
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.92e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 459-575
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.14e-33
Family Pyk2-associated protein beta ARF-GAP domain 0.001
Further Details:      
 
Domain Number 3 Region: 111-136,210-343
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-28
Family Pleckstrin-homology domain (PH domain) 0.00091
Further Details:      
 
Domain Number 4 Region: 601-772
Classification Level Classification E-value
Superfamily PH domain-like 2.16e-26
Family Pleckstrin-homology domain (PH domain) 0.0045
Further Details:      
 
Domain Number 5 Region: 1201-1356
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000181
Family Pleckstrin-homology domain (PH domain) 0.038
Further Details:      
 
Domain Number 6 Region: 366-460
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000554
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 7 Region: 8-57
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000314
Family SAM (sterile alpha motif) domain 0.018
Further Details:      
 
Domain Number 8 Region: 787-915
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000277
Family Pleckstrin-homology domain (PH domain) 0.0098
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007650
Domain Number - Region: 1102-1186
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00176
Family Ras-binding domain, RBD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007650   Gene: ENSGGOG00000007805   Transcript: ENSGGOT00000007855
Sequence length 1374
Comment pep:known_by_projection chromosome:gorGor3.1:11:69610106:69651723:-1 gene:ENSGGOG00000007805 transcript:ENSGGOT00000007855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAGDAVLSVAEWLRALHLEQYTGLFEQHGLVWATECQGLNDARLMDMGMLLPGHSTAA
PDPVLPPLPAKRHLAELSVPPVPPRTGPPRLLVSLPTKEEESLLPSLSSPPQPQSEEPLS
ALPQGPPQPPSPPPCPPEIPPKPVRLFPEFDDSDYDEVPEEGPGAPARVMTKKEEPPPSR
VPRAVRVASLLSEGEELSGDDQGDEEEDDHAYEGVPNGGWHTSSLSLSLPSTIAAPHPMD
GPPGGSTPVTPVIKAGWLDKNPPQGSYIYQKRWVRLDTDHLRYFDSNKDAYSKRFISVAC
ISHVAAIGDQKFEVITNNRTFAFRAESDVERKEWMQALQQAMAEQRARARLSSAYLLGVP
GSEQPDRAGSLELRGFKNKLYVAVVGDKVQLYKNLEEYHLGIGITFIDMSVGNVKEVDRR
SFDLTTPYRIFSFSADSELEKEQWLEAMQGAIAEALSTSEVAERIWAAAPNRFCADCGAP
QPDWASINLCVVICKRCAGEHRGLGAGVSKVRSLKMDRKVWTETLIELFLQLGNGAGNRF
WAANVPPSEALQPSSSPSTRRCHLEAKYREGKYRRYHPLFGNQEELDKALCAAVTTTDLA
ETQALLGCGAGINCFSGDPEAPTPLALAEQAGQTLQMEFLRNNRTTEVPRLDSMKPLEKH
YSVVLPTVSHSGFLYKTASAGKLLQDRRAREEFSRRWCVLGDGVLSYFENERAVTPNGEI
RASEIVCLAVPPPDTHGFEHTFEVYTEGERLYLFGLESTEQAHEWVKCIAKAFVPPLAED
LLARDFERLGRLPYKAGLSLQRAQEGWFSLSGSELRAVFPEGPCEEPLQLRKLQELSIQG
DSENQVLVLVERRRTLYIQGERRLDFMGWLGAIQKAAASMGDTLSEQQLGDSDIPVIVYR
CVDYITQCGLTSEGIYRKCGQTSKTQRLLESLRQDARSVHLKEGEQHVDDVSSALKRFLR
DLPDGLFTRAQRLAWLEASEIEDEEEKVSRYRELLVRLPPVNRATVKALISHLYCVQCFS
DTNQMNVHNLAIVFGPTLFQTDGQDYKAGRVVEDLINHYVVVFSVDEEELRKQREEITAI
VKMRVAGTASGTQHAGDFICTVYLEEKKAETEQHIKIPASMTAEELTLEILDRRNVGIRE
KDYWTCFEVNEREEAERPLHFAEKVLPILHGLGTDSHLVVKKHQAMEAMLLYLASRVGDT
KHGMMKFREDRSLLGLGLPSGGFHDRYFILNSSCLRLYKEVRSQRPWSGAPETSHRPEKE
WPVKSLKVYLGVKKKLRPPTCWGFTVVHETEKHEKQQWYLCCDTQMELREWFATFLFVQH
DGLVWPSEPSRVSRAVPEVRLGSVSLIPLRGSENEMRRSVAAFTADPLSLLRNV
Download sequence
Identical sequences ENSGGOP00000007650 ENSGGOP00000007650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]