SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007660 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007660
Domain Number 1 Region: 718-826
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-25
Family Spermadhesin, CUB domain 0.0021
Further Details:      
 
Domain Number 2 Region: 321-440
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.59e-18
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 42-174
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.24e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 4 Region: 283-327
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000377
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 174-211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000233
Family EGF-type module 0.019
Further Details:      
 
Domain Number 6 Region: 579-714
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000408
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 7 Region: 214-254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000529
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007660   Gene: ENSGGOG00000007825   Transcript: ENSGGOT00000007866
Sequence length 904
Comment pep:known_by_projection chromosome:gorGor3.1:11:9137018:9211665:-1 gene:ENSGGOG00000007825 transcript:ENSGGOT00000007866 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVAGRNRPGAAWAVLLLLLPPLLLAGAVPPGRGRAAGPQEDVDECAQGLDDCHADALCQ
NTPTSYKCSCKPGYQGEGRQCEDIDECGNELNGGCVHDCLNIPGNYRCTCFDGFMLAHDG
HNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSDNQHTCIHRSEEGLSCMNKDHG
CSHICKEAPRGSVACECRPGFELAKNQRDCILTCNHGNGGCQHSCDDTADGPECSCHPQY
KMHTDGRSCLEREDIVLEVTESNTTSVVDGDKRVKRRLLMETCAVNNGGCDRTCKDTSTG
VHCSCPVGFTLQLDGKTCKDIDECQTRNGGCDHFCKNTVGSFDCSCKKGFKLLTDEKSCQ
DVDECSLDRTCDHSCINHPGTFACACNRGYTLYGFTHCGDTNECSINNGGCQQVCVNTVG
SYECQCHPGYKLHWNKKDCVEVKGLLPTSVSPRVSLHCGKSGGGDGCFLRCHSGIHLSSG
LQGAYSVTCGSSSPLRNKQQKSNDSAFGDVATIRTSVTFKLNEGKCSLKKAELFPEGLRP
SLPVSCRAGTYYDGTQERCILCPNGTFQNEEGQITCEPCPRPGNSGALTTPEAWNMSECG
GLCQPGEYSADGFAPCQLCALGTFQPEAGRTSCFPCGGGLATKHQGATSFQDCETRVQCS
PGHFYNTTTHRCIRCPVGTYQPEFGKNNCVSCPGNTTTDFDGSTNITQCKNRRCGGELGD
FTGYIESPNYPGNYPANTECTWTINPPPKRRILIVVPEIFLPIEDDCGDYLVMRKTSSSN
SVTTYETCQTYERPIAFTSRSKKLWIQFKSNEGNSARGFQVPYVTYDEDYQELIEDIVRD
GRLYASENHQEILKDKKLIKALFDVLAHPQNYFKYTAQESREMFPRSFIRLLRSKVSRFL
RPYK
Download sequence
Identical sequences ENSGGOP00000007660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]