SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007676 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007676
Domain Number 1 Region: 309-593
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.51e-90
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000101
Further Details:      
 
Domain Number 2 Region: 132-306
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.96e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00015
Further Details:      
 
Domain Number 3 Region: 595-702
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.1e-26
Family Anticodon-binding domain of Class II aaRS 0.0013
Further Details:      
 
Domain Number 4 Region: 71-131
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000218
Family TGS domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007676   Gene: ENSGGOG00000007839   Transcript: ENSGGOT00000007883
Sequence length 712
Comment pep:known_by_projection chromosome:gorGor3.1:15:81816477:81888884:-1 gene:ENSGGOG00000007839 transcript:ENSGGOT00000007883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQEAGAQPPSSQSQDKDMKKKKMKESEADSEVKHQPIFIKERLKLFEILKKDHQLLLAIY
GKKGDTSNIITVRVADGQTVQGEVWKTTPYQVAAEISQELAESTVIAKVNGELWDLDRPL
EGDSSLELLTFDNEEAQAVYWHSSAHILGEAMELYYGGHLCYGPPIENGFYYDMFIEDRA
VSSTELSALENICKAIIKEKQPFERLEVSKEILLEMFKYNKFKCRILNEKVNTATTTVYR
CGPLIDLCKGPHVRHTGKIKTIKIFKNSSTYWEGNPEMETLQRIYGISFPDNKMMRDWEK
FQEEAKNRDHRKIGKEQELFFFHDLSPGSCFFLPRGAFIYNTLTDFIREEYHKRDFTEVL
SPNMYNSKLWEASGHWQHYSENMFTFEIEKDTFALKPMNCPGHCLMFAHRPRSWREMPIR
FADFGVLHRNELSGTLSGLTRVRRFQQDDAHIFCTVEQIEEEIKGCLQFLQSVYSTFGFS
FQLNLSTRPENFLGEIEMWNEAEKKKQLQNSLMDFGEPWKMNPGDGAFYGPKIDIKIKDA
IGRYHQCATIQLDFQLPIRFNLTYVSKDGDDKKRPVIIHRAILGSVERMIAILSENYGGK
WPFWLSPRQVMVIPVGPTCEKYALQVSSEFFEEGFMADVDLDHNCTLNKKIRNAQLAQYN
FILVVGEKEKIDNAVNVRTRDNKIHGEILVTSAIDKLKNLKKTRTLNAEEAF
Download sequence
Identical sequences ENSGGOP00000007676 ENSGGOP00000007676

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]