SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007695 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007695
Domain Number 1 Region: 6-116
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-36
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 2 Region: 268-388
Classification Level Classification E-value
Superfamily TIMP-like 1.41e-35
Family Netrin-like domain (NTR/C345C module) 0.00031
Further Details:      
 
Domain Number 3 Region: 127-240
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-33
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007695   Gene: ENSGGOG00000007872   Transcript: ENSGGOT00000007902
Sequence length 388
Comment pep:known_by_projection chromosome:gorGor3.1:3:143144836:143215843:-1 gene:ENSGGOG00000007872 transcript:ENSGGOT00000007902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPVFTCGGILTGESGFIGSEGFPGVYPPNSKCTWKITVPEGKVVVLNFRFIDLESDNLCR
YDFVDVYNGHANGQRIGRFCGTFRPGALVSSGNKMMVQMISDANTAGNGFMAMFSAAEPN
ERGDQYCGGRLDRPSGSFKTPNWPDRDYPAGVTCVWHIVAPKNQLIELKFEKFDVERDNY
CRYDYVAVFNGGEVNDARRIGKYCGDSPPAPIVSERNELLIQFLSDLSLTADGFIGHYKF
RPKKLPTTTEQPVTTTFPVTTGLKPTVALCQQKCRRTGTLEGNYCSSDFVLAGTVITTIT
RDGSLHATVSIINIYKEGNLAIQQAGKNMSARLTVVCKQCPLLRRGLNYIIMGQVGEDGR
GKIMPNSFIMMFKTKNQKLLDALKNKQC
Download sequence
Identical sequences ENSGGOP00000007695 ENSGGOP00000007695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]