SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007696 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007696
Domain Number 1 Region: 125-252
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000659
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 2 Region: 261-306
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000859
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 3 Region: 227-255,603-784
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000613
Family Rhodopsin-like 0.028
Further Details:      
 
Domain Number 4 Region: 74-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000781
Family EGF-type module 0.01
Further Details:      
 
Domain Number 5 Region: 33-68
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000761
Family EGF-type module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007696   Gene: ENSGGOG00000007858   Transcript: ENSGGOT00000007903
Sequence length 834
Comment pep:known_by_projection chromosome:gorGor3.1:19:7087617:7141298:1 gene:ENSGGOG00000007858 transcript:ENSGGOT00000007903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGFNLLLFWGCCVMHSWERHIRPTQKPNTKGNNCRDSTLCPAYATCTNTVDSYYCTCKR
GFLSSNGQNHFKGPGVRCKDIDECSQSPQPCGPNSSCKNLSGRYKCSCLDGFSSPTGNDW
VPGKSGNFSCTDINECLTSTVCPEHSDCVNSMGSYSCSCQVGFIPRNSTCEDVDECADPR
ACPEHATCNNTVGNYSCFCNPGFESSSGHLSFQGLEASCEDIDECTEMCPINSTCTNTPG
SYFCTCHPGFAPSNGQLNFTDQEVVCRDIDECRQDPSTCGPNSICTNALGSYSCGCVVGF
HPNPEGSQKDGNFSCQRVLFKCKEDVIPDNKQIQQCQEGTTVKPAYAIVSFCAQINNIFS
VLDKVCENKTTIVSPKNTTESFVPVLKQISTWTKFTKEQTSSLATVFLESVESMTLASFR
KPSANVTLAVRTEYLDIESKVINKECSEENVTLNLVAKGDKMKIRCSTIEESESTGTTGV
AFVSFVGMESVLNEHFFQDHQAPLTTSEIKLKMNSRVIGGIMTGEKKDGFSDPVIYTLEN
IQPKQKFERPICVSWSTDVKGGRWTSFGCVILEASETYTVCSCNQMANLAVIMASGELTM
DFSLYIISHVGIIISLVCLVLAIATFLLCRSIRNHITYLHLHLCVCLLLAKTLFLAGIHK
TDNKTGCAIIAGFLHYLFLACFFWMLVEAVILFLMVRNLKVVNYFSSRNIKMLHICAFGY
GLPTLVVVISASVQPQGYGMHNRCWLNTETGFIWSFLGPVCTVIITGQINSLLLTWTLWI
LRQRLSSVNAEVSTLKDTVREEYKRWITGKTKPSSQSQTSRILLSSMPSASKTG
Download sequence
Identical sequences ENSGGOP00000007696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]