SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007715 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007715
Domain Number 1 Region: 8-244
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.52e-35
Family Ankyrin repeat 0.00062
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007715
Domain Number - Region: 260-306
Classification Level Classification E-value
Superfamily SOCS box-like 0.000262
Family SOCS box-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007715   Gene: ENSGGOG00000007888   Transcript: ENSGGOT00000007922
Sequence length 309
Comment pep:known_by_projection chromosome:gorGor3.1:X:61460148:61466547:-1 gene:ENSGGOG00000007888 transcript:ENSGGOT00000007922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLMDITKIFSLLQPDKEEEDTDTEEKQALNQAVYDNDSYTLDQLLRQERYKRFINSRSG
WGVPGTPLRLAASYGHLSCLQVLLAHGADVDSLDVKAQTPLFTAVSHGHLDCVRVLLEAG
ACPGGSIYNNCSPVLTAARDGAVAILQELLGHGAEANVKAKLPVWASNIASCSGPLYLAA
VYGHLDCFRLLLLHGADPDYNCTDQGLLARVPRPRTLLEICLHHNCEPEYIQLLIDFGAN
IYLPSLSLDLTSQDDKGIALLLQARATPRSLLSQARLVVRRALCQAGQRQAINQLDIPPM
LISYLKHQL
Download sequence
Identical sequences ENSGGOP00000007715 ENSGGOP00000007715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]