SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007717 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007717
Domain Number 1 Region: 10-168
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.87e-31
Family G proteins 0.0001
Further Details:      
 
Domain Number 2 Region: 168-207
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000693
Family SOCS box-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007717   Gene: ENSGGOG00000007887   Transcript: ENSGGOT00000007924
Sequence length 260
Comment pep:known_by_projection chromosome:gorGor3.1:16:641943:677707:1 gene:ENSGGOG00000007887 transcript:ENSGGOT00000007924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAYSNGIDYKTTTILLDG
RRVKLELGILLVYDITNRWSFDGIDRWIKEIDEHAPGVPRILVGNRLHLAFKRQVPTEQA
RAYAEKNCMTFFEVSPLCNFNVIESFTELSRIVLMRHGMEKIWRPNRVFSLQDLCCRAIV
SCTPVHLIDKLPLPVTIKSHLKSFSMANGMNAVMMHGRSYSLASGAGGGGSKGNSLKRSK
SIRPPQSPPQNCSRSNCKIS
Download sequence
Identical sequences A0A2I3H165
ENSGGOP00000007717 ENSGGOP00000007717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]