SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007719 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007719
Domain Number 1 Region: 18-309
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.37e-89
Family Amylase, catalytic domain 0.000000000365
Further Details:      
 
Domain Number 2 Region: 310-403
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 6.83e-27
Family alpha-Amylases, C-terminal beta-sheet domain 0.0000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007719   Gene: ENSGGOG00000007889   Transcript: ENSGGOT00000007926
Sequence length 411
Comment pep:known_by_projection chromosome:gorGor3.1:22:26425953:26440149:-1 gene:ENSGGOG00000007889 transcript:ENSGGOT00000007926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLKTVLLLGHVSQVLMLDNGLLQTPPMGWLAWERFRCNINCDEDPKNCISERLFMEMAD
RLAQDGWRDMGYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYA
DMGNFTCMGYPGTTLDKVVQDAQTFAEWKVDMLKLDGCFSTPEERAQGYPKMAAALNATG
RPIAFSCSWPAYEGGLPPRVNYSLLADICNLWRNYDDIQDSWWSVLSILNWFVEHQDILQ
PVAGPGHWNDPDMLLIGNFGLSLEQSRAQMALWTVLAAPLLMSTDLRTISAQNMDILQNP
LMIKINQDPLGIQGRRIHKEKSLIEVYMRPLSNKASALVFFSRRTDMPYRYHSSLGQLNF
TGSVIYEAQDVYSGDIISDLRDETNFTVIINPSGVVMWYLYPIKNLEMSQQ
Download sequence
Identical sequences G3QXZ9
XP_018873852.1.27298 XP_018873853.1.27298 ENSGGOP00000007719 ENSGGOP00000007719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]