SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007729 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007729
Domain Number 1 Region: 3-66
Classification Level Classification E-value
Superfamily SAP domain 1.19e-20
Family SAP domain 0.00026
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007729
Domain Number - Region: 323-387
Classification Level Classification E-value
Superfamily RING/U-box 0.00328
Family RING finger domain, C3HC4 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007729   Gene: ENSGGOG00000007895   Transcript: ENSGGOT00000007936
Sequence length 509
Comment pep:known_by_projection chromosome:gorGor3.1:19:4101908:4131729:1 gene:ENSGGOG00000007895 transcript:ENSGGOT00000007936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKE
LYETRYAKKNSEPAPQPHRPLDPLTMHSTYDRAGAVPRTPLAGPNIDYPVLYGKYLNGLG
RLPAKTLKPEVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSR
CAAPPPAQHPAARICYSDTSCPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPCR
PINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLTSSELLQRLKTIGVKHPELCKA
LVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKKP
TWMCPVCDKPAPYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGAI
LVLGPSDASGLLPAPSVNGSGALGSTGGGGPVGSVENGKPGADVVDLTLDSSSSSEEEEE
EEEEEEDEDEEGPRPKRRCPFQKGLVPAC
Download sequence
Identical sequences ENSGGOP00000007729 ENSGGOP00000007729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]