SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007731 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007731
Domain Number 1 Region: 379-594
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-104
Family Thrombospondin C-terminal domain 0.000000089
Further Details:      
 
Domain Number 2 Region: 256-377
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.44e-35
Family TSP type-3 repeat 0.0000033
Further Details:      
 
Domain Number 3 Region: 28-73
Classification Level Classification E-value
Superfamily Assembly domain of cartilage oligomeric matrix protein 1.96e-17
Family Assembly domain of cartilage oligomeric matrix protein 0.00012
Further Details:      
 
Domain Number 4 Region: 175-258
Classification Level Classification E-value
Superfamily TSP type-3 repeat 4.32e-17
Family TSP type-3 repeat 0.0000599
Further Details:      
 
Domain Number 5 Region: 121-159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000021
Family EGF-type module 0.027
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007731
Domain Number - Region: 90-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0618
Family EGF-type module 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007731   Gene: ENSGGOG00000007897   Transcript: ENSGGOT00000007938
Sequence length 607
Comment pep:known_by_projection chromosome:gorGor3.1:19:19190859:19199293:-1 gene:ENSGGOG00000007897 transcript:ENSGGOT00000007938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPDTACVLLLTLAALGASGQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREIT
FLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGFCFPGVACIQTESGARCGPCPAGFTG
NGSHCTDVNECNAHPCFPRVRCINTSPGFRCEACPPGYSGPTHVGAVLAHAQANKDNCPL
VRNPDQRNTDEDKWGDACDNCRSQKNDDQKDTDQDGRGDACDDDIDGDRIRNQADNCPRV
PNSDQKDSDGDGIGDACDNCPQKSNPDQADVDHDFVGDACDSDQDQDGDGHQDSWDNCPT
VPNSAQEDSDHDGQGDACDDDDDNDGVPDSRDNCRLVPNPGQEDANRDGVGDVCQDDFDA
DKVVDKIDVCPENAEVTLTDFRAFQTVVLDPEGDAQIDPNWVVLNQGREIVQTMNSDPGL
AVGYTAFNGVDFEGTFHVNTVTDDDYAGFIFGYQDSSSFYVVMWKQMEQTYWQANPFRAV
AEPGIQLKAVKSSTGPGEQLRNALWHTGDTESQVRLLWKDPRNVGWKDKKSYRWFLQHRP
QVGYIRVRFYEGPELVADSNVVLDTTMRGGRLGVFCFSQENIIWANLRYRCNDTIPEDYE
THQLRRA
Download sequence
Identical sequences ENSGGOP00000007731 ENSGGOP00000007731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]