SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007734 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007734
Domain Number 1 Region: 266-566
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.66e-92
Family beta-glycanases 0.0000000000167
Further Details:      
 
Domain Number 2 Region: 24-224
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.58e-58
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.0000000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007734   Gene: ENSGGOG00000007902   Transcript: ENSGGOT00000007941
Sequence length 588
Comment pep:known_by_projection chromosome:gorGor3.1:7:62866208:62890079:-1 gene:ENSGGOG00000007902 transcript:ENSGGOT00000007941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGSAVAWAALGPLLWGCALGLQGGMLYPQESPSRECKKLDGLWSFRADFSDNRRRGFE
EQWYRRPLWESGPTVDMPVPSSFNDISQDWRLRHFVGWVWYEREVILPERWTQDLRTRVV
LRIGSAHSYAIVWVNGVDTLEHEGGYLPFEADISNLVQVGPLPSRLRITIAINNTLTPTT
LPPGTIQYLTDTSKYPKGYFVQNTYFDFFNYAGLQRSVLLYTTPTTYIDDITVTTSVEQD
SVQLTAQTSLGPVSDFYTLPVGIRTVAVTKSQFLINGKPFYFHGVNKHEDADIRGKGFDW
PLLVKDFNLLRWLGANAFRTSHYPYAEEVLQMCDRYGIVVIDECPGVGLALPQFFNNVSL
HHHMQVMEEVVRRDKNHPAVVMWSVANEPASHLESAGYYLKMVIAHTKALDPSRPVTFVS
NSNYAADKGAPYVDVICLNSYYSWYHDYGHLELIQLQLATQFENWYKKYQKPIIQSEYGA
ETIAGFHQDPPLMFTEEYQKSLLEQYHLGLDQKRRKYVVGELIWNFADFMTEQSPTRVLG
NKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPFT
Download sequence
Identical sequences ENSGGOP00000007734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]