SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007759 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007759
Domain Number 1 Region: 162-246
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.000000000112
Family HSP20 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007759   Gene: ENSGGOG00000007936   Transcript: ENSGGOT00000007967
Sequence length 258
Comment pep:known_by_projection chromosome:gorGor3.1:1:16503696:16508455:-1 gene:ENSGGOG00000007936 transcript:ENSGGOT00000007967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGCELSPLGLRVGLSAGPAHGRRFPAPSGPWRGLNLASRQGAGPKPRDSRPYKAAAVRA
WHARPEACTHTLSCPALARLGRARRRPWMSHRTSSTFRAERSFHSSSSSSSSSTSSSASR
ALPAQDPPMEKALSMFSDDFGSFMRPHSEPLAFPARPGGAGNIKTLGDAYEFAVDVRDFS
PEDIIVTTSNNHIEVRAEKLAADGTVMNTFAHKCQLPEDVDPTSVTSALREDGSLTIRAR
RHPHTEHVQQTFRTEIKI
Download sequence
Identical sequences G3QY36
ENSGGOP00000007759 XP_004024780.1.27298 ENSGGOP00000007759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]