SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007811 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007811
Domain Number 1 Region: 811-950
Classification Level Classification E-value
Superfamily post-AAA+ oligomerization domain-like 2.89e-48
Family DNA polymerase III clamp loader subunits, C-terminal domain 0.0000808
Further Details:      
 
Domain Number 2 Region: 549-799
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.96e-33
Family Extended AAA-ATPase domain 0.00000401
Further Details:      
 
Domain Number 3 Region: 405-482
Classification Level Classification E-value
Superfamily BRCT domain 7.71e-18
Family DNA ligase 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007811   Gene: ENSGGOG00000007977   Transcript: ENSGGOT00000008023
Sequence length 1113
Comment pep:known_by_projection chromosome:gorGor3.1:4:39594066:39673637:-1 gene:ENSGGOG00000007977 transcript:ENSGGOT00000008023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEDTLKAKKGIKEIKVNSSLKEDDFKQKQPS
KKKRIIYDSDTDSESEESLQVKNAKKQPEKPPVSSKPGKISRQDPVTYISETDEEDDFMC
KKAASKSKENGRSTNSHLGTSNMKKNEENTKTKNKPLSPIKLTPTSVLDYFGTGSVQRSN
KKMVASKRKELSENTDESGLNDEAIAKQLQLDEDAELERQLHEDEEFARTLAMLDEEPKT
KKARKDTEAGETFSSVQANLSKAEKHKYPHKVKTAQVSDERKSYSPRKQSKYESSKESQQ
HSKSSADKIGEVSSPKASSKLAIMKSKEESSYKEIEPVASKRKENAIKLKGETKTPKKTK
SSPAKKESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEGLIFVITGVL
ESIERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNL
IRTMPGKKSKYEIAVETEMKKESKLERTPQKNVQGKRKISPSKKESESKKSRPTWNLADD
SSENKVENLLWVDKYKPTSLKTIIGQQGDQSCANKLLRWLRNWQKSSSEDKKHAAKFGKF
SGKDDGSSFKAALLSGPPGVGKTTTASLVCQELGYSYVELNASDTRSKSSLKAIVAESLN
NTSIKGFYSNGAASSVSTKHALIMDEVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDR
NHPKIRSLVHYCFDLRFQRPRVEQIKGAMMSIAFKEGLKIPPPAMNEIILGANQDIRQVL
HNLSMWCARSKALTYDQAKADSHRAKKDIKMGPFDVARKVFAAGEETAHMSLVDKSDLFF
HDYSIAPLFVQENYIHVKPVAAGGDMKKHLMLLSRAADSICDGDLVDSQIRSKQNWSLLP
AQAIYASVLPGELMRGYMTQFPTFPSWLGKHSSTGKHDRIVQDLALHMSLRTYSSKRTVN
MDYLSLLRDALVQPLTSQGVDGVQDVVALMDTYYLMKEDFENIMEISSWGGKPSPFSKLD
PKVKAAFTRAYNKEAHLTPYSLQAIKASRHSTSPSLDSEYNEELNEDDSQSDEKDQDAIE
TDAMIKKKTKSSKPSKPEKDKEPRKGKGKSSKK
Download sequence
Identical sequences ENSGGOP00000007811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]