SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007813 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007813
Domain Number 1 Region: 570-674
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 2.26e-28
Family Lipoxigenase N-terminal domain 0.025
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007813
Domain Number - Region: 1297-1341,1379-1501
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00157
Family Voltage-gated potassium channels 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007813   Gene: ENSGGOG00000007972   Transcript: ENSGGOT00000008025
Sequence length 1555
Comment pep:known_by_projection chromosome:gorGor3.1:16:62190828:62260322:-1 gene:ENSGGOG00000007972 transcript:ENSGGOT00000008025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVAANGPPKPPSCTYLSRNFIRISSKGDKCLLKYYFICQTGDFLDGDAHYERNGNNSHLY
QRHKKTKRGVAIARDKMPPSKTLCHPISPFPSVLPSITSQVTSAASEPSSQPLPVITQLT
TPVSVMHAGQSLAETTSSPKEEAHPNTFTSYLQVSLQKASGQVIDEIAGNFSRAVHGLQA
HNKLQEACEFLQKLTALTPRFSKPAQVEDILEMSLVEFGNIGEAFLEQNQSPESSVTLTS
SIATLLLSRQNISTLPLSSYTLGHPAPVRLGFPSALALKELLNKHPGVNVQITGLAFNPF
KDLDNRNIVGSIGSVLLSANRKLLQVHDLMEDIEIMLWRNVSLETHPTSLNMSTHQLTIT
VNMTSLEKSLIVSIDPDSPLLMTLYLGFQYQPNCTHFHLNITLPKDKVWQKDEEYTWVLT
PEHLQHGIGTYYITAVLSERQEGAQQTPGLVSVITAVTQCYYWEIHNQTWSSTGCQVGPQ
STILRTQCLCNHLTFFASDFFVVPRTVNVEDTIELFLRVTNNPVGVSLLASLLGFYVITV
VWARKKDQADMQKVKVTVLADNDPSAQFHYLIQVYTGYRRRAATTAKVVITLYGSEGRSE
PHHLCDPQKTVFERGGLDVFLLTTWTSLGDLHSLRLWHDNSGVSPSWYVSQVIVCDMAVK
RKWHFLCNCWLAVDLGDCELDRVFIPVSKRELFSFRHLFSSMIVEKFTQDYLWLSIATRH
PWNQFTRVQRLSCCMTLLLCNMVINVMFWKINSTTAKRDEQMGPFAVAWSELLISIHTAV
ILLPINLVIGRVFPLVEPQETLPFFPPVQASCLSDASVEPLSATMVVEELKETVRFLLRR
NTYLLSKCEQPPWSSWDITKLVKLLSSLVSSHLEGQGCHQQGERHWALVVPENHRHFCCY
LHRVLQRLKSHLGTLGLTQGHQSFDFLDAASQLQKLQELLETHILPTEQEPSREVTSFAI
LSSEEGKKPISNGLSKWLTSVCWLLLGLTSLASAFFTALYSLELSKDQATSWMISIILSV
LQNIFISQPVKVVFFTFLYSLMMSRMPRLNKENEQQRILALLAKCSSSVPGSRDKNNPVY
VAPAMNSPTKHPERTLKKKKLFKLTGDILVQILFLTLLITAIYSAKNSNRFYLHQAIWKT
FSHQFSEIKRLQDFYPWANHILLPSLYGDYRGKNVVLEPSHCKCGVQLIFQIPHTKTYEK
VEEGQLAFCDNGHTCGRPKSLFPGLHLRRFSYISSPRPMVLIPTDELHKRLTSKNENGFS
YIMRGAFFTSVRLESFTSLQMSKKGCVWSIISQVIYYLLVCYYAFIQGCQLKQQKWRFFT
GKRNILDTSIILISFILLGLDMKSISLHKKNMARYRDDQDRFISFYEAVKVNSAATHLVG
FLVLLATVQLWNLLHHSPRLRVISRTLSRAWDEVVGFLLIILILLTGYAIAFNLLFGCSI
SDYRTFFSSAVTVVGLLMGISHQEEVFALDPVLGTFLILTSVILMVLVVINLFVSAILMA
FGKERKSLKKEAALIDTLLQKLSNLLGISWPQKTSSEQATTTAMGNDTEVLDELP
Download sequence
Identical sequences ENSGGOP00000007813 ENSGGOP00000007813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]