SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007814 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007814
Domain Number 1 Region: 69-135
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 6.65e-16
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 2 Region: 164-228
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000000208
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 3 Region: 260-290
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000149
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007814   Gene: ENSGGOG00000007989   Transcript: ENSGGOT00000008026
Sequence length 321
Comment pep:known_by_projection chromosome:gorGor3.1:2b:80237939:80489882:-1 gene:ENSGGOG00000007989 transcript:ENSGGOT00000008026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLWESPRQCSSWTLCEGFCWLLLLPVMLLIVARPVKLAAFPTSLSDCQTPTGWNCSGYD
DRENDLFLCDTNTCKFDGECLRIGDTVTCVCQFKCNNDYVPVCGSNGESYQNECYLRQAA
CKQQSEILVVSEGSCATDAGSGSGDGVHEGSGETSQKETSTCDICQFGAECDEDAEDVWC
VCNIDCSQTNFNPLCASDGKSYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDG
HYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRKCPRSNRIHR
QKQNTGHYSSDNTTRASTRLI
Download sequence
Identical sequences G3QY84
ENSGGOP00000007814 ENSGGOP00000007814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]