SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007828 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007828
Domain Number 1 Region: 67-265
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 4.97e-61
Family Apolipoprotein A-I 0.00000000405
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007828   Gene: ENSGGOG00000008006   Transcript: ENSGGOT00000008040
Sequence length 267
Comment pep:known chromosome:gorGor3.1:11:114733231:114735119:-1 gene:ENSGGOG00000008006 transcript:ENSGGOT00000008040 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGS
ALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAK
VQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHV
DALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQ
GLLPVLESFKVSFLSALEEYTKKLNTQ
Download sequence
Identical sequences A0A024R3E3 G3QY98 K7D1U8 P02647 P0DJG0
ENSP00000236850 ENSP00000352471 ENSP00000364469 ENSP00000364472 ENSPTRP00000007404 9598.ENSPTRP00000007404 9606.ENSP00000236850 NP_000030.1.87134 NP_000030.1.92137 NP_001304946.1.87134 NP_001304946.1.92137 NP_001304947.1.87134 NP_001304947.1.92137 XP_001153383.1.37143 XP_001153517.1.37143 XP_004052230.1.27298 XP_016777528.1.37143 XP_016777529.1.37143 XP_016777530.1.37143 XP_508770.1.37143 ENSP00000236850 ENSPTRP00000007404 ENSGGOP00000007828 ENSGGOP00000007828 ENSP00000236850 ENSP00000352471 ENSP00000364469 ENSP00000364472 gi|4557321|ref|NP_000030.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]