SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007856 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007856
Domain Number 1 Region: 4-353
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.03e-140
Family Calpain large subunit, catalytic domain (domain II) 0.00000000000226
Further Details:      
 
Domain Number 2 Region: 356-513
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 3.66e-58
Family Calpain large subunit, middle domain (domain III) 0.0000000193
Further Details:      
 
Domain Number 3 Region: 523-675
Classification Level Classification E-value
Superfamily EF-hand 2.44e-37
Family Penta-EF-hand proteins 0.000000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007856   Gene: ENSGGOG00000008027   Transcript: ENSGGOT00000008068
Sequence length 680
Comment pep:known_by_projection chromosome:gorGor3.1:1:204146891:204208799:1 gene:ENSGGOG00000008027 transcript:ENSGGOT00000008068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGIAAKLAKDREAAEGLGSHERAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGF
KELGPYSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEI
LARVVPLNQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSAL
LEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGC
SIDITSAADSEAITFQKLVKGHAYSVTGAEEVESNGSLQKLIRIRNPWGEVEWTGRWNDN
CPSWNTIDPEERERLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKLTK
MDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEEDGESGCTFLVGLIQKHRRRQR
KMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLTNRARERSDTFINLREVLNRFKLPPG
EYILVPSTFEPNKDGDFCIRVFSEKKADYQAVDDEIEANLEEFDISEDDIDDGFRRLFAQ
LAGEQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYILWTKIQKYQKIYREIDIDRSG
TMNSYEMRKALEEAGFKMPCQLHQVIVARFADDQLIINFDNFVRCLVRLETLFKIFKQLD
PENTGTIELDLISWLCFSVL
Download sequence
Identical sequences ENSGGOP00000007856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]