SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007863 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007863
Domain Number 1 Region: 136-242
Classification Level Classification E-value
Superfamily R3H domain 1.51e-19
Family R3H domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007863   Gene: ENSGGOG00000008040   Transcript: ENSGGOT00000008075
Sequence length 244
Comment pep:known_by_projection chromosome:gorGor3.1:19:854225:859998:-1 gene:ENSGGOG00000008040 transcript:ENSGGOT00000008075 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLPSCLPALASSQVKRLSASRRKQHFINQAVRNSDLVPKAKGRKSLQRLENTQYLLTLLE
TDGGPPGLEDGDLAPPASPGIFAEACNNATYVEVWNDFMNRSGEEQERVLRYLEDEGRSK
ARRRGPGRGEDRRREDPAYTPRECFQRISRRLRAVLKRSRIPMETLETWEERLLRFFSVS
PQAVYTAMLDNSFERLLLHAVCQYMDLISASADLEGKRQMKVSNRHLDFLPPGLLLSAYL
EQHS
Download sequence
Identical sequences ENSGGOP00000007863 ENSGGOP00000007863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]