SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007886 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007886
Domain Number 1 Region: 32-61,179-349
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.18e-63
Family G proteins 0.0000000293
Further Details:      
 
Domain Number 2 Region: 61-181
Classification Level Classification E-value
Superfamily Transducin (alpha subunit), insertion domain 9.52e-45
Family Transducin (alpha subunit), insertion domain 0.00000037
Further Details:      
 
Domain Number 3 Region: 8-62
Classification Level Classification E-value
Superfamily PDB 7.88e-27
Family PDB 0.0000921
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007886   Gene: ENSGGOG00000008064   Transcript: ENSGGOT00000008101
Sequence length 354
Comment pep:known_by_projection chromosome:gorGor3.1:7:77195704:77306721:1 gene:ENSGGOG00000008064 transcript:ENSGGOT00000008101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
Download sequence
Identical sequences A0A0D9RHH6 A0A1S3AKH7 A0A1U7U5W0 A0A2J8VLH0 A0A2K5D5T1 A0A2K5J1P2 A0A2K5RI89 A0A2K5U8P3 A0A2K6D442 B2RSH2 F1SB90 G3QYF3 G3TPI4 H2QUU5 H9EPA7 M3W792 M3Z3L1 P63096 P63097 Q3LRD4
ENSGGOP00000007886 ENSGGOP00000007886 ENSPTRP00000033088 ENSTTRP00000006121 ENSBTAP00000003515 ENSMUSP00000074259 ENSMUSP00000074259 ENSMPUP00000018173 ENSP00000343027 6dde_A 6ddf_A 10090.ENSMUSP00000074259 9598.ENSPTRP00000033088 9606.ENSP00000343027 9913.ENSBTAP00000044585 gi|33946324|ref|NP_002060.4| ENSMUSP00000074259 ENSBTAP00000003515 NP_001230985.1.28591 NP_001230985.1.69978 NP_002060.4.87134 NP_002060.4.92137 NP_034435.1.92730 NP_776749.1.59421 NP_776749.1.76553 XP_001159548.1.37143 XP_003407227.1.64505 XP_004045698.1.27298 XP_004263451.1.21590 XP_004381521.1.4749 XP_004393684.1.74151 XP_004676952.1.23501 XP_004739667.1.14098 XP_005358400.1.66349 XP_005550437.1.63531 XP_005679147.2.57651 XP_005900911.1.15283 XP_005966527.1.78601 XP_006733015.1.47382 XP_006925804.1.64745 XP_007114569.1.24612 XP_007187183.1.59432 XP_007467102.1.90284 XP_007467103.1.90284 XP_007536385.1.11023 XP_007942986.1.48129 XP_007980565.1.81039 XP_008060667.1.4292 XP_010846405.1.44457 XP_010991680.1.51371 XP_011278647.1.62641 XP_011363523.1.92234 XP_011728885.1.29376 XP_012321972.1.9421 XP_014950733.1.66739 XP_014989675.1.72884 XP_015324318.1.76553 XP_016015105.1.101085 XP_016015106.1.101085 XP_016015107.1.101085 XP_016015108.1.101085 XP_017378614.1.71028 XP_019306837.1.44245 XP_019517135.1.44202 XP_019517136.1.44202 XP_019796077.1.83887 XP_019796078.1.83887 XP_019814161.1.53367 XP_020738565.1.74333 XP_020738566.1.74333 XP_020919153.1.46622 XP_021044455.1.100879 XP_021545252.1.83697 ENSPVAP00000000666 ENSPVAP00000000666 ENSPTRP00000033088 ENSMPUP00000018173 ENSLAFP00000017307 ENSTTRP00000006121 ENSP00000388347 ENSLAFP00000017307 ENSP00000343027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]