SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007901 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007901
Domain Number 1 Region: 18-301
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.76e-51
Family Ankyrin repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 497-643
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.11e-37
Family Ankyrin repeat 0.00035
Further Details:      
 
Domain Number 3 Region: 333-400
Classification Level Classification E-value
Superfamily EF-hand 0.0000000728
Family Calmodulin-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007901   Gene: ENSGGOG00000008079   Transcript: ENSGGOT00000008117
Sequence length 776
Comment pep:known_by_projection chromosome:gorGor3.1:20:10269799:10293422:1 gene:ENSGGOG00000008079 transcript:ENSGGOT00000008117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALADKRLENLQIYKVLQCVRNKDKKQIEKLTKLGYPELINYTEPINGLSALHLASVSND
IDMVSFLLDLGAHPDVQDRMGCTPTMRAAELGHELSMEILAKAKADMTIVDNEGKGVLFY
CILPTKRHYRCALIALEHGADVNNSTYEGKPIFLRACEDAHDVKDVCLTFLEKGANPNAI
NSSTGRTALMEASREGVVEIVRGILERGGEVNAFDNDRHHAAHFAAKGGFLDILKLLFAC
NGDVGLISINGNTPLHYAAIGGFADCCKYIAQRGCDLKWKNLDHKTPRAVAKEGGFKAAS
KEIRRAERIANKLARPGAKNPNPLWALRLHDWSVEREAFLREAFAVLDRGDGSISKNDFV
MVLEERQDYASSEQLAAIAQLHEKTRGGGVNINEFFKGTRYLNKSFVLGSYGPKKKEKGM
GKKGKKGKFVLPLPICVIPEYAFPRRQDGGPPYYMIETYKNVTDSSRFNRDHPPEHPIQD
DSAWYIDDSEKVFSNINIITKAGDLASLKKAFESGIPVDMKDNYYKTPLMTACASGNTDV
VKFLLEKGANVNATDNFLWTPLHFACHAGQQDIVELLVESGALIDAASINNSTPLNRAIE
SCRLDTVKYLLDIGAKFQLENRKGHSAMDVAKAYADYRIIDLIKEKLDNLPKPAENQKLK
GKTPPILKTEGLEIKKEEELLSSVYGVPTTSEGKKVQKGNVVHLNSLITSGYTKKVDITF
IPRRIWSPEATTAELIRKRELRRERFTHEVDFDDFMMPFQKNITEKARALEAALKT
Download sequence
Identical sequences G3QYG6
ENSGGOP00000007901 XP_004061854.1.27298 ENSGGOP00000007901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]