SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007916 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007916
Domain Number 1 Region: 1167-1283
Classification Level Classification E-value
Superfamily Second domain of FERM 6.15e-23
Family Second domain of FERM 0.0024
Further Details:      
 
Domain Number 2 Region: 463-566
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.41e-21
Family First domain of FERM 0.033
Further Details:      
 
Domain Number 3 Region: 1284-1374
Classification Level Classification E-value
Superfamily PH domain-like 9.59e-21
Family Third domain of FERM 0.015
Further Details:      
 
Domain Number 4 Region: 558-652
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000000000222
Family Second domain of FERM 0.0076
Further Details:      
 
Domain Number 5 Region: 817-887
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000618
Family SH3-domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000007916
Domain Number - Region: 6-74
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000154
Family Motor proteins 0.018
Further Details:      
 
Domain Number - Region: 1105-1144
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0827
Family Ras-binding domain, RBD 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007916   Gene: ENSGGOG00000008082   Transcript: ENSGGOT00000008132
Sequence length 1388
Comment pep:known_by_projection chromosome:gorGor3.1:11:74205706:74244961:1 gene:ENSGGOG00000008082 transcript:ENSGGOT00000008132 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLGFLRLQALHRSRKLHQQYRLARQRIIQFQARCRAYLVRKAFRHRLWAVLTVQAYARG
MIARRLHQRLRAEYLRRLEAEKMRLAEEEKLRKEMSAKKAKEEAERKHQERLAQLAREDA
ERELKEKEAARRKKELLEQMERARHEPVNHSDMVDKMFGFLGTSGGLPGQEGQAPSGFED
LERGRREMVEEDLDAALPLPDEDEEDLSEYKFAKFAATYFQGTTTHSYTRRPLKQPLLYH
DDEGDQLAALAVWITILRFMGDLPEPKYHTAMSDGSEKIPVMTKIYETLGKKTYKRELQA
LQGEGEAQLPEGQKKSSVRHKLVHLTLKKKSKLTEEVTKRLHDGESTVQGNSMLEDRPTS
NLEKLHFIIGNGILRPALRDEIYCQISKQLTHNPSKSSYARGWILVSLCVGCFAPSEKFV
KYLRNFIHGGPPGYAPYCEERLRRTFVNGTRTQPPSWLELQATKSKKPIMLPVTFMDGTT
KTLLTDSATTAKELCNALADKISLKDRFGFSLYIALFDKVSSLGSGSDHVMDAISQCEQY
AKEQGAQERNAPWRLFFRKEVFTPWHSPSEDNVATNLIYQQVVRGVKFGEYRCEKEDDLA
ELASQQYFVDYGSEMILERLLNLVPTYIPDREITPLKTLEKWAQLAIAAHKKGIYAQRRT
DAQKVKEDVVNYARFKWPLLFSRFYEAYKFSGPSLPKNDVIVAVNWTGVYFVDEQEQVLL
ELSFPEIMAVSSSRECRVWLSLGCSDLGCAAPRSGWAGLTPAGPCSPCWSCRGAKTTAPS
FTLATIKGDEYTFTSSNAEDIRDLVVTFLEGLRKRSKYVVALQDNPNPAGEESGFLSFAK
GDLIILDHDTGEQVMNSGWANGINERTKQRGDFPTDCVYVMPTVTMPPREIVALVTMTPD
QRQDVVRLLQLRTAEPEVRAKPYTLEEFSYDYFRPPPKHTLSRVMVSKARGKDRLWSHTR
EPLKQALLKKLLGSEELSQEACLAFIAVLKYMGDYPSKRTRSVNELTDQIFEGPLKAEPL
KDEAYVQILKQLTDNHIRYSEERGWELLWLCTGLFPPSNILLPHVQRFLQSRKHCPLAID
CLQRLQKALRNGSRKYPPHLVEVEAIQHKTTQIFHKVYFPDDTDEVISVPENDFFFDFVR
HLTDWIKKARPIKDGIVPSLTYQVFFMKKLWTTTVPGKDPMADSIFHYYQELPKYLRGYH
KCTREEVLQLGALIYRVKFEEDKSYFPSIPKLLRELVPQDLIRQVSPDDWKRSIVAYFNK
HAGKSKEEAKLAFLKLIFKWPTFGSAFFEVKQTTEPNFPEILLIAINKYGVSLIDPKTKD
ILTTHPFTKISNWSSGNTYFHITIGNLVRGSKLLCETSLGYKMDDLLTSYISQMLTAMSK
QRGSRSGK
Download sequence
Identical sequences ENSGGOP00000007916 ENSGGOP00000007916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]