SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007926 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007926
Domain Number 1 Region: 196-455
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 3.66e-53
Family Glycerophosphoryl diester phosphodiesterase 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007926   Gene: ENSGGOG00000008102   Transcript: ENSGGOT00000008143
Sequence length 628
Comment pep:known_by_projection chromosome:gorGor3.1:11:74247194:74314836:-1 gene:ENSGGOG00000008102 transcript:ENSGGOT00000008143 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFLWIETSNEYFNFDWVTFLGTGYWFFWSIFILSLAGILTAYSSLLLLLGFLLLWERI
ELYLHLCHKILILLVILLCVILMFIIYKFWKERWLVAGLSLQIFAPYVHLVSITVMVILF
WPVAFYVARLERKVRMRRYRMTHSEKKRLKKCNVITRLRGLQVAVGLPFLLILLSLYLMP
LGIYSPCIQEKENLGPKPTIFGHRGAPMLGPENTMMSFEKAVEHGAHGLETDIHLSYDHV
PFLMHDFDLKRTTNIGEVQPESAFENPAFFNWDFLSTPNAGKWFVKPELRPFYNMKPLSE
ADKERARNQSIPTLADLLTLAEKERKFVIFDLHCPPPKHPLRHTFVHQVVSVILASKIEQ
HLIFWLPAHDRQYVRSVAPGFQHVGRLVSVETLAKNNISIINVDYKKLFPNGLRDYKAAN
IHINVYTVNEPWLFSLAWCSRINSVTTDNTGLLSQLDHPHFFMTPKFYVFMWLLADIISV
LFIVAIFCFHWWRETEKEKLFETSSTRTDTQSGSENEEDLHIAMKPPARVVESPWTLAAL
YPALPKSGKEHQGHFNFAAPSKKLLPIKNAVTPLKPGKHEIQPPMPTTVFELTQAPTRQA
TSEATFQTTLPTLKVDKPTMPSIEVPYP
Download sequence
Identical sequences ENSGGOP00000007926 ENSGGOP00000007926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]