SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007946 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007946
Domain Number 1 Region: 2-172
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.93e-19
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007946   Gene: ENSGGOG00000008129   Transcript: ENSGGOT00000008163
Sequence length 296
Comment pep:novel chromosome:gorGor3.1:14:71758884:71759774:-1 gene:ENSGGOG00000008129 transcript:ENSGGOT00000008163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGMTTPATVGGKIFLIFYGLVGCSSTILFFNLFLERLITIIAYIMKSCHQRQLRRRGALP
QESLKDAGQCEGDSLAGWKPSVYYVMLILCTASILISCCASAMYTPIEGWSYFDSLYFCF
VAFSTIGFGDLVSSQNAHYESQGLYRFANFVFILMGVCCIYSLFNVISILIKQSLNWILR
KMDSGCCPQCQRGLLRSRRNVVMPGSVRNRCNISIETDGVAESDTDGRRLSGEMISMKDL
LAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGAFAIMNNRLAETSGDR
Download sequence
Identical sequences ENSGGOP00000007946 ENSGGOP00000007946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]