SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000007957 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000007957
Domain Number 1 Region: 117-174
Classification Level Classification E-value
Superfamily EF-hand 0.000000131
Family Calmodulin-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000007957   Gene: ENSGGOG00000008141   Transcript: ENSGGOT00000008175
Sequence length 470
Comment pep:known_by_projection chromosome:gorGor3.1:16:40257257:40346378:1 gene:ENSGGOG00000008141 transcript:ENSGGOT00000008175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKLHSKPAAVCKRRESPEGDSFAVSAAWARKGIEEWIGRQRCPGGVSGPQQLRLAGTIG
RSTRELVGDVLRDTLSEEEEDDFRLEVALPPEKTDGLGSGDEKKMERVSEPCPGSKKQLK
FEELQCDVSVEEDSRQEWTFTLYDFDNNGKVTREDITSLLHTIYEVVDSSVNHSPTSSKM
LRVKLTVAPDGSQSKRSVLVNQADLQSARPRAETKPTEDLRSWEKKQRAPLRFQGDSRLE
QSGCYHHCVDENIERRNHYLDLAGIENYTSQFGPGSPSVAQKSELPPRTSNPTRSRSHEP
EAIHVPHRKPQGVDPASFHFLDTPIAKVSELQQRLRGTQDGSKHFVRSPKAQGKSVGVGH
VARGARNKPPLGPAIPAVSPSAHLAASPALLPSLAPLGHKKHKHRAKESQQGCRGLQAPL
ASGGPVLGREHLRELPALVVYESQAGQPVQRHEHHHHHEHHHHYHHFYQT
Download sequence
Identical sequences G3QYL6
XP_004057680.1.27298 ENSGGOP00000007957 ENSGGOP00000007957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]